• Gene id: 84366

Gene Summary

• Gene Symbol: PRAC1   Gene   UCSC   Ensembl
• Aliases: C17orf92, PRAC
• Gene name: PRAC1 small nuclear protein
• Alternate names: small nuclear protein PRAC1, prostate cancer susceptibility candidate 1, prostate cancer susceptibility candidate protein 1, prostate, rectum and colon expressed gene protein, small nuclear protein PRAC,
• Gene location: 17q21.32 (26223084: 26132114)     Exons: 10     NC_000013.11
• Gene summary(Entrez): This gene is reported to be specifically expressed in prostate, rectum and distal colon. Sequence analysis suggests that it may play a regulatory role in the nucleus. [provided by RefSeq, Jul 2008]
• OMIM: 609819

Protein Summary

• Protein general information: Q96KF2  
  • Name: Small nuclear protein PRAC1 (Prostate cancer susceptibility candidate protein 1) (Prostate, rectum and colon expressed gene protein)
  • Length: 57  
  • Mass: 5959
  • Tissue specificity: Highly expressed in prostate, rectum, and distal colon, and weakly expressed in bladder. Expressed in prostate cancer cell lines. {ECO
• Sequence:

  MLCAHFSDQGPAHLTTSKSAFLSNKKTSTLKHLLGETRSDGSACNSGISGGRGRKIP

• Structural information:
  • STRING: ENSP00000290294
• Other Databases: GeneCards:  PRAC1  Malacards:  PRAC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)