• Gene id: 84365

Gene Summary

• Gene Symbol: NIFK   Gene   UCSC   Ensembl
• Aliases: MKI67IP, Nopp34
• Gene name: nucleolar protein interacting with the FHA domain of MKI67
• Alternate names: MKI67 FHA domain-interacting nucleolar phosphoprotein, hNIFK, nucleolar phosphoprotein Nopp34, nucleolar protein interacting with the FHA domain of pKi-67,
• Gene location: 2q14.3 (121736874: 121726944)     Exons: 7     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 1
• OMIM: 611970

Protein Summary

• Protein general information: Q9BYG3  
  • Name: MKI67 FHA domain interacting nucleolar phosphoprotein (Nucleolar phosphoprotein Nopp34) (Nucleolar protein interacting with the FHA domain of pKI 67) (hNIFK)
  • Length: 293  
  • Mass: 34222
• Sequence:

  MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFR
  LSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYPSVKRYN
  RNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPE
  KTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ

• Structural information:
  • Protein Domains: (45..12-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR021043  IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • PDB: 2AFF
  • PDBsum: 2AFF
  • DIP: 28134
  • STRING: ENSP00000285814
• Other Databases: GeneCards:  NIFK  Malacards:  NIFK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0005730	nucleolus	IBA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0000794	condensed nuclear chromosome	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0009303	rRNA transcription	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0065003	protein-containing complex assembly	NAS	biological process
GO:0016072	rRNA metabolic process	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881