• Gene id: 84340

Gene Summary

• Gene Symbol: GFM2   Gene   UCSC   Ensembl
• Aliases: EF-G2mt, EFG2, MRRF2, MST027, MSTP027, RRF, RRF2, RRF2mt, hEFG2, mEF-G 2
• Gene name: GTP dependent ribosome recycling factor mitochondrial 2
• Alternate names: ribosome-releasing factor 2, mitochondrial, G elongation factor mitochondrial 2, mitochondrial elongation factor G2, mitochondrial ribosome recycling factor 2, mitochondrial ribosome-releasing factor 2, ribosome releasing factor 2,
• Gene location: 5q13.3 (74767370: 74721205)     Exons: 7     NC_000005.10
• Gene summary(Entrez): Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-o
• OMIM: 606544

Protein Summary

• Protein general information: Q969S9  
  • Name: Ribosome releasing factor 2, mitochondrial (RRF2mt) (Elongation factor G 2, mitochondrial) (EF G2mt) (mEF G 2) (Elongation factor G2) (hEFG2)
  • Length: 779  
  • Mass: 86601
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MLTNLRIFAMSHQTIPSVYINNICCYKIRASLKRLKPHVPLGRNCSSLPGLIGNDIKSLHSIINPPIAKIRNIGI
  MAHIDAGKTTTTERILYYSGYTRSLGDVDDGDTVTDFMAQERERGITIQSAAVTFDWKGYRVNLIDTPGHVDFTL
  EVERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKHNIPRICFLNKMDKTGASFKYAVESIREKLKAKPLLLQLP
  IGEAKTFKGVVDVVMKEKLLWNCNSNDGKDFERKPLLEMNDPELLKETTEARNALIEQVADLDDEFADLVLEEFS
  ENFDLLPAEKLQTAIHRVTLAQTAVPVLCGSALKNKGIQPLLDAVTMYLPSPEERNYEFLQWYKDDLCALAFKVL
  HDKQRGPLVFMRIYSGTIKPQLAIHNINGNCTERISRLLLPFADQHVEIPSLTAGNIALTVGLKHTATGDTIVSS
  KSSALAAARRAEREGEKKHRQNNEAERLLLAGVEIPEPVFFCTIEPPSLSKQPDLEHALKCLQREDPSLKVRLDP
  DSGQTVLCGMGELHIEIIHDRIKREYGLETYLGPLQVAYRETILNSVRATDTLDRTLGDKRHLVTVEVEARPIET
  SSVMPVIEFEYAESINEGLLKVSQEAIENGIHSACLQGPLLGSPIQDVAITLHSLTIHPGTSTTMISACVSRCVQ
  KALKKADKQVLEPLMNLEVTVARDYLSPVLADLAQRRGNIQEIQTRQDNKVVIGFVPLAEIMGYSTVLRTLTSGS
  ATFALELSTYQAMNPQDQNTLLNRRSGLT

• Structural information:
  • Protein Domains: (68..35-)
    (/note="tr-type-G")
  • Interpro: IPR030851  IPR041095  IPR009022  IPR035647  IPR035649   IPR000640  IPR004161  IPR031157  IPR027417  IPR020568  IPR014721  IPR005225  IPR000795  IPR009000  IPR005517  
  • Prosite: PS00301 PS51722
  • CDD: cd16262 cd03713
  • DIP: 53437
  • STRING: ENSP00000296805
• Other Databases: GeneCards:  GFM2  Malacards:  GFM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032543	mitochondrial translation	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0032790	ribosome disassembly	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0032543	mitochondrial translation	IDA	biological process
GO:0003924	GTPase activity	IDA	molecular function
GO:0003746	translation elongation factor activity	IDA	NOT|molecular function
GO:0070125	mitochondrial translational elongation	IDA	NOT|biological process
GO:0032790	ribosome disassembly	IDA	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0032790	ribosome disassembly	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003924	GTPase activity	EXP	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0070126	mitochondrial translational termination	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0032543	mitochondrial translation	IEA	biological process
GO:0032790	ribosome disassembly	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0006414	translational elongation	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)