• Gene id: 8434

Gene Summary

• Gene Symbol: RECK   Gene   UCSC   Ensembl
• Aliases: ST15
• Gene name: reversion inducing cysteine rich protein with kazal motifs
• Alternate names: reversion-inducing cysteine-rich protein with Kazal motifs, membrane-anchored glycoprotein (metastasis and invasion), suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich protein with kazal motifs), suppression of tumorigenicity 5 (reversion-in,
• Gene location: 9p13.3 (36036904: 36124454)     Exons: 25     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anch
• OMIM: 611316

Protein Summary

• Protein general information: O95980  
  • Name: Reversion inducing cysteine rich protein with Kazal motifs (hRECK) (Suppressor of tumorigenicity 15 protein)
  • Length: 971  
  • Mass: 106457
  • Tissue specificity: Expressed in various tissues and untransformed cells (PubMed
• Sequence:

  MATVRASLRGALLLLLAVAGVAEVAGGLAPGSAGALCCNHSKDNQMCRDVCEQIFSSKSESRLKHLLQRAPDYCP
  ETMVEIWNCMNSSLPGVFKKSDGWVGLGCCELAIALECRQACKQASSKNDISKVCRKEYENALFSCISRNEMGSV
  CCSYAGHHTNCREYCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHAC
  QNACKRILMSKKTEMEIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPPPSTGLDGAKLHCCSKANTST
  CRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVSMLTCLADVREPCQLGCRNLTYCTNFNNRPTELFRSCNAQSD
  QGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIACSLQIKPCHSKSRGSIICKSDCVEILKKCGDQNKFP
  EDHTAESICELLSPTDDLKNCIPLDTYLRPSTLGNIVEEVTHPCNPNPCPANELCEVNRKGCPSGDPCLPYFCVQ
  GCKLGEASDFIVRQGTLIQVPSSAGEVGCYKICSCGQSGLLENCMEMHCIDLQKSCIVGGKRKSHGTSFSIDCNV
  CSCFAGNLVCSTRLCLSEHSSEDDRRTFTGLPCNCADQFVPVCGQNGRTYPSACIARCVGLQDHQFEFGSCMSKD
  PCNPNPCQKNQRCIPKPQVCLTTFDKFGCSQYECVPRQLACDQVQDPVCDTDHMEHNNLCTLYQRGKSLSYKGPC
  QPFCRATEPVCGHNGETYSSVCAAYSDRVAVDYYGDCQAVGVLSEHSSVAECASVKCPSLLAAGCKPIIPPGACC
  PLCAGMLRVLFDKEKLDTIAKVTNKKPITVLEILQKIRMHVSVPQCDVFGYFSIESEIVILIIPVDHYPKALQIE
  ACNKEAEKIESLINSDSPTLASHVPLSALIISQVQVSSSVPSAGVRARPSCHSLLLPLSLGLALHLLWTYN

• Structural information:
  • Protein Domains: (627..67-)
    (/note="Kazal-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798-)
    (698..75-)
    (/note="Kazal-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00798-)
    (753..78-)
    (/note="Kazal-like-3)
    (/evidence="ECO:0000255|PROSITE-P-)
  • Interpro: IPR002350  IPR036058  IPR039016  
  • Prosite: PS00282 PS51465
  • STRING: ENSP00000367202
• Other Databases: GeneCards:  RECK  Malacards:  RECK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004866	endopeptidase inhibitor activity	IBA	molecular function
GO:0001955	blood vessel maturation	IBA	biological process
GO:1904684	negative regulation of metalloendopeptidase activity	IBA	biological process
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:1904684	negative regulation of metalloendopeptidase activity	IDA	biological process
GO:0008191	metalloendopeptidase inhibitor activity	IDA	molecular function
GO:0008191	metalloendopeptidase inhibitor activity	IEA	molecular function
GO:1904684	negative regulation of metalloendopeptidase activity	IEA	biological process
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0008191	metalloendopeptidase inhibitor activity	TAS	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0004866	endopeptidase inhibitor activity	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0001955	blood vessel maturation	IEA	biological process
GO:0004866	endopeptidase inhibitor activity	IEA	molecular function
GO:0007566	embryo implantation	IEA	biological process
GO:1904928	coreceptor activity involved in canonical Wnt signaling pathway	IEA	molecular function
GO:1990909	Wnt signalosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0035115	embryonic forelimb morphogenesis	IEA	biological process
GO:0045765	regulation of angiogenesis	IEA	biological process
GO:0090210	regulation of establishment of blood-brain barrier	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:1904684	negative regulation of metalloendopeptidase activity	IEA	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:1904684	negative regulation of metalloendopeptidase activity	ISS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0060070	canonical Wnt signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05206	MicroRNAs in cancer

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R