• Gene id: 84335

Gene Summary

• Gene Symbol: AKT1S1   Gene   UCSC   Ensembl
• Aliases: Lobe, PRAS40
• Gene name: AKT1 substrate 1
• Alternate names: proline-rich AKT1 substrate 1, 40 kDa proline-rich AKT substrate, AKT1 substrate 1 (proline rich),
• Gene location: 19q13.33 (49878355: 49869032)     Exons: 7     NC_000019.10
• Gene summary(Entrez): AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM, Mar 2008]
• OMIM: 609228

Protein Summary

• Protein general information: Q96B36  
  • Name: Proline rich AKT1 substrate 1 (40 kDa proline rich AKT substrate)
  • Length: 256  
  • Mass: 27383
  • Tissue specificity: Widely expressed with highest levels of expression in liver and heart. Expressed at higher levels in cancer cell lines (e.g. A-549 and HeLa) than in normal cell lines (e.g. HEK293). {ECO
• Sequence:

  MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARRCLHDIALAHRAATAA
  RPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDLPPFCESDPES
  TDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRAL
  VLREAEDTQVFGDLPRPRLNTSDFQKLKRKY

• Structural information:
  • Interpro: IPR026682  
  • PDB: 5WBL 5WBU 5WBY 6SB0
  • PDBsum: 5WBL 5WBU 5WBY 6SB0
  • STRING: ENSP00000375711
• Other Databases: GeneCards:  AKT1S1  Malacards:  AKT1S1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032007	negative regulation of TOR signaling	IBA	biological process
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0031931	TORC1 complex	IDA	colocalizes with
GO:0005515	protein binding	IPI	molecular function
GO:0032007	negative regulation of TOR signaling	IEA	biological process
GO:0048011	neurotrophin TRK receptor signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0032007	negative regulation of TOR signaling	IDA	biological process
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0045792	negative regulation of cell size	IDA	biological process
GO:0042981	regulation of apoptotic process	ISS	biological process
GO:0043523	regulation of neuron apoptotic process	ISS	biological process
GO:0005829	cytosol	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04714	Thermogenesis
hsa05131	Shigellosis
hsa04150	mTOR signaling pathway
hsa04140	Autophagy - animal
hsa04152	AMPK signaling pathway
hsa04211	Longevity regulating pathway
hsa04213	Longevity regulating pathway - multiple species
P06959	CCKR signaling map

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881