• Gene id: 84333

Gene Summary

• Gene Symbol: PCGF5   Gene   UCSC   Ensembl
• Aliases: RNF159
• Gene name: polycomb group ring finger 5
• Alternate names: polycomb group RING finger protein 5, RING finger protein 159, ring finger protein (C3HC4 type) 159,
• Gene location: 10q23.32 (91162401: 91284336)     Exons: 15     NC_000010.11
• OMIM: 617407

Protein Summary

• Protein general information: Q86SE9  
  • Name: Polycomb group RING finger protein 5 (RING finger protein 159)
  • Length: 256  
  • Mass: 29714
• Sequence:

  MATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHETNPLEMLRLDNTL
  EEIIFKLVPGLREQELERESEFWKKNKPQENGQDDTSKADKPKVDEEGDENEDDKDYHRSDPQIAICLDCLRNNG
  QSGDNVVKGLMKKFIRCSTRVTVGTIKKFLSLKLKLPSSYELDVLCNGEIMGKDHTMEFIYMTRWRLRGENFRCL
  NCSASQVCSQDGPLYQSYPMVLQYRPRIDFG

• Structural information:
  • Interpro: IPR032443  IPR001841  IPR013083  IPR017907  
  • Prosite: PS00518 PS50089
  • PDB: 4S3O
  • PDBsum: 4S3O
  • DIP: 61356
  • STRING: ENSP00000445704
• Other Databases: GeneCards:  PCGF5  Malacards:  PCGF5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0031519	PcG protein complex	IBA	cellular component
GO:0036353	histone H2A-K119 monoubiquitination	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0035102	PRC1 complex	IBA	cellular component
GO:0060819	inactivation of X chromosome by genetic imprinting	IBA	biological process
GO:0031519	PcG protein complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000805	X chromosome	ISS	colocalizes with
GO:0060819	inactivation of X chromosome by genetic imprinting	ISS	biological process
GO:0036353	histone H2A-K119 monoubiquitination	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060819	inactivation of X chromosome by genetic imprinting	IEA	biological process
GO:0000805	X chromosome	IEA	cellular component
GO:0036353	histone H2A-K119 monoubiquitination	IEA	biological process
GO:0031519	PcG protein complex	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04550	Signaling pathways regulating pluripotency of stem cells

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R