• Gene id: 84328

Gene Summary

• Gene Symbol: LZIC   Gene   UCSC   Ensembl
• Gene name: leucine zipper and CTNNBIP1 domain containing
• Alternate names: protein LZIC, leucine zipper and CTNNBIP1 domain-containing protein, leucine zipper and ICAT homologous domain-containing protein, leucine zipper domain and ICAT homologous domain containing,
• Gene location: 1p36.22 (9943401: 9922117)     Exons: 10     NC_000001.11
• OMIM: 610458

Protein Summary

• Protein general information: Q8WZA0  
  • Name: Protein LZIC (Leucine zipper and CTNNBIP1 domain containing protein) (Leucine zipper and ICAT homologous domain containing protein)
  • Length: 190  
  • Mass: 21495
  • Tissue specificity: Ubiquitously expressed, with highest levels in kidney. Up-regulated in several cases of gastric cancers. {ECO
• Sequence:

  MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELS
  GMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDE
  AFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK

• Structural information:
  • Interpro: IPR009428  IPR036911  IPR040065  
  • STRING: ENSP00000366430
• Other Databases: GeneCards:  LZIC  Malacards:  LZIC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010212	response to ionizing radiation	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray