• Gene id: 84327

Gene Summary

• Gene Symbol: ZBED3   Gene   UCSC   Ensembl
• Gene name: zinc finger BED-type containing 3
• Alternate names: zinc finger BED domain-containing protein 3, 2610005H11Rik, axin-interacting protein, zinc finger, BED domain containing 3,
• Gene location: 5q13.3 (77087284: 77072071)     Exons: 4     NC_000005.10
• Gene summary(Entrez): This gene belongs to a class of genes that arose through hAT DNA transposition and that encode regulatory proteins. This gene is upregulated in lung cancer tissues, where the encoded protein causes an accumulation of beta-catenin and enhanced lung cancer
• OMIM: 614659

Protein Summary

• Protein general information: Q96IU2  
  • Name: Zinc finger BED domain containing protein 3 (Axin interacting protein)
  • Length: 234  
  • Mass: 25132
• Sequence:

  MRSGEPACTMDQARGLDDAAARGGQCPGLGPAPTPTPPGRLGAPYSEAWGYFHLAPGRPGHPSGHWATCRLCGEQ
  VGRGPGFHAGTSALWRHLRSAHRRELESSGAGSSPPAAPCPPPPGPAAAPEGDWARLLEQMGALAVRGSRREREL
  ERRELAVEQGERALERRRRALQEEERAAAQARRELQAEREALQARLRDVSRREGALGWAPAAPPPLKDDPEGDRD
  GCVITKVLL

• Structural information:
  • Interpro: IPR033546  IPR003656  IPR036236  
  • Prosite: PS50808
  • STRING: ENSP00000255198
• Other Databases: GeneCards:  ZBED3  Malacards:  ZBED3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0050821	protein stabilization	ISS	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0001933	negative regulation of protein phosphorylation	ISS	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0016020	membrane	ISS	cellular component
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0050821	protein stabilization	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0050821	protein stabilization	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881