• Gene id: 84324

Gene Summary

• Gene Symbol: SARNP   Gene   UCSC   Ensembl
• Aliases: CIP29, HCC1, HSPC316, THO1
• Gene name: SAP domain containing ribonucleoprotein
• Alternate names: SAP domain-containing ribonucleoprotein, cytokine induced protein 29 kDa, cytokine-induced protein of 29 kDa, hepatocellular carcinoma 1, nuclear protein Hcc-1, proliferation associated cytokine-inducible protein CIP29,
• Gene location: 12q13.2 (55817755: 55752462)     Exons: 12     NC_000012.12
• Gene summary(Entrez): This gene encodes a protein that is upregulated in response to various cytokines. The encoded protein may play a role in cell cycle progression. A translocation between this gene and the myeloid/lymphoid leukemia gene, resulting in expression of a chimeri
• OMIM: 610049

Protein Summary

• Protein general information: P82979  
  • Name: SAP domain containing ribonucleoprotein (Cytokine induced protein of 29 kDa) (Nuclear protein Hcc 1) (Proliferation associated cytokine inducible protein CIP29)
  • Length: 210  
  • Mass: 23671
  • Tissue specificity: Low expression in spleen, liver, pancreas, testis, thymus, heart, and kidney. Increased levels are seen in hepatocellular carcinoma and pancreatic adenocarcinoma. {ECO
• Sequence:

  MATETVELHKLKLAELKQECLARGLETKGIKQDLIHRLQAYLEEHAEEEANEEDVLGDETEEEETKPIELPVKEE
  EPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKKAARAARFGISSVPTKGLSSDNKPMVNLDKL
  KERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAERFGIA

• Structural information:
  • Protein Domains: (8..4-)
    (/note="SAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00186"-)
  • Interpro: IPR003034  IPR036361  
  • Prosite: PS50800
  • PDB: 2DO1
  • PDBsum: 2DO1
  • STRING: ENSP00000337632
• Other Databases: GeneCards:  SARNP  Malacards:  SARNP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016607	nuclear speck	IDA	cellular component
GO:0006406	mRNA export from nucleus	IDA	biological process
GO:0000346	transcription export complex	IDA	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006405	RNA export from nucleus	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0050733	RS domain binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005634	nucleus	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R