• Gene id: 84321

Gene Summary

• Gene Symbol: THOC3   Gene   UCSC   Ensembl
• Aliases: THO3, hTREX45
• Gene name: THO complex 3
• Alternate names: THO complex subunit 3, TEX1 homolog,
• Gene location: 5q35.2 (176034904: 175959530)     Exons: 8     NC_000005.10
• Gene summary(Entrez): This gene encodes a component of the nuclear THO transcription elongation complex, which is part of the larger transcription export (TREX) complex that couples messenger RNA processing and export. In humans, the transcription export complex is recruited t
• OMIM: 606929

Protein Summary

• Protein general information: Q96J01  
  • Name: THO complex subunit 3 (Tho3) (TEX1 homolog) (hTREX45)
  • Length: 351  
  • Mass: 38772
• Sequence:

  MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQELFRGHSKTREFLAHSAKVHSVAWSCDGRRLASGSF
  DKTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASGDKTIRIWDVRTTKCIATVNTKGENINICWS
  PDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLTNGNGCINILSYPELKPVQSINAHPS
  NCICIKFDPMGKYFATGSADALVSLWDVDELVCVRCFSRLDWPVRTLSFSHDGKMLASASEDHFIDIAEVETGDK
  LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPNDS

• Structural information:
  • Interpro: IPR024977  IPR020472  IPR040132  IPR013979  IPR015943   IPR001680  IPR017986  IPR036322  
  • Prosite: PS50082 PS50294
  • STRING: ENSP00000265097
• Other Databases: GeneCards:  THOC3  Malacards:  THOC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000445	THO complex part of transcription export complex	IBA	cellular component
GO:0006406	mRNA export from nucleus	IBA	biological process
GO:0046784	viral mRNA export from host cell nucleus	IDA	biological process
GO:0000445	THO complex part of transcription export complex	IDA	cellular component
GO:0006406	mRNA export from nucleus	IDA	biological process
GO:0000346	transcription export complex	IDA	cellular component
GO:0000346	transcription export complex	IDA	cellular component
GO:0006406	mRNA export from nucleus	IEA	biological process
GO:0051028	mRNA transport	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006405	RNA export from nucleus	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0000784	nuclear chromosome, telomeric region	IDA	colocalizes with
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa03040	Spliceosome

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)