• Gene id: 84320

Gene Summary

• Gene Symbol: ACBD6   Gene   UCSC   Ensembl
• Gene name: acyl-CoA binding domain containing 6
• Alternate names: acyl-CoA-binding domain-containing protein 6, acyl-Coenzyme A binding domain containing 6,
• Gene location: 1q25.2-q25.3 (180502576: 180269662)     Exons: 11     NC_000001.11
• OMIM: 601945

Protein Summary

• Protein general information: Q9BR61  
  • Name: Acyl CoA binding domain containing protein 6
  • Length: 282  
  • Mass: 31151
  • Tissue specificity: Detected in placenta and spleen (at protein level). Detected in placenta, umbilical cord blood, CD34-positive hematopoietic progenitor cells and bone marrow. {ECO
• Sequence:

  MASSFLPAGAITGDSGGELSSGDDSGEVEFPHSPEIEETSCLAELFEKAAAHLQGLIQVASREQLLYLYARYKQV
  KVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKKLDPGWNPQIPEKKGKEANTGFGGPVISSLY
  HEETIREEDKNIFDYCRENNIDHITKAIKSKNVDVNVKDEEGRALLHWACDRGHKELVTVLLQHRADINCQDNEG
  QTALHYASACEFLDIVELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQRHTTGKA

• Structural information:
  • Protein Domains: (42..12-)
    (/note="ACB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00573"-)
  • Interpro: IPR000582  IPR035984  IPR002110  IPR020683  IPR036770   IPR014352  
  • Prosite: PS51228 PS50297 PS50088
  • PDB: 2COP
  • PDBsum: 2COP
  • STRING: ENSP00000356567
• Other Databases: GeneCards:  ACBD6  Malacards:  ACBD6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000062	fatty-acyl-CoA binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006637	acyl-CoA metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray