About Us

Search Result


Gene id 84316
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol NAA38   Gene   UCSC   Ensembl
Aliases LSMD1, MAK31, PFAAP2
Gene name N-alpha-acetyltransferase 38, NatC auxiliary subunit
Alternate names N-alpha-acetyltransferase 38, NatC auxiliary subunit, LSM domain containing 1, LSM domain-containing protein 1, phosphonoformate immuno-associated protein 2,
Gene location 17p13.1 (7885419: 7856680)     Exons: 6     NC_000017.11
OMIM 611241

Protein Summary

Protein general information Q9BRA0  

Name: N alpha acetyltransferase 38, NatC auxiliary subunit (LSM domain containing protein 1) (Phosphonoformate immuno associated protein 2)

Length: 125  Mass: 13514

Sequence MAGAGPTMLLREENGCCSRRQSSSSAGDSDGEREDSAAERARQQLEALLNKTMRIRMTDGRTLVGCFLCTDRDCN
VILGSAQEFLKPSDSFSAGEPRVLGLAMVPGHHIVSIEVQRESLTGPPYL
Structural information
Interpro:  IPR001163  IPR010920  IPR034110  
CDD:   cd06168
STRING:   ENSP00000332103
Other Databases GeneCards:  NAA38  Malacards:  NAA38

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0031417 NatC complex
IDA cellular component
GO:0005844 polysome
IDA colocalizes with
GO:0005737 cytoplasm
IDA cellular component
GO:0005634 nucleus
IDA cellular component
GO:0043066 negative regulation of ap
optotic process
IMP biological process
GO:0031417 NatC complex
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005737 cytoplasm
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0005654 nucleoplasm
IDA cellular component
Associated diseases References
Hypospermatogenesis MIK: 28361989
Spermatogenic defects MIK: 31037746

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28361989 Hyposperma
togenesis

6 (3 controls,
3 Klienfelter s
yndrome
Male infertility Microarray
Show abstract
31037746 Spermatoge
nic defect
s

28 men with az
oospermia
Male infertility Microarray
Show abstract