• Gene id: 84313

Gene Summary

• Gene Symbol: VPS25   Gene   UCSC   Ensembl
• Aliases: DERP9, EAP20, FAP20
• Gene name: vacuolar protein sorting 25 homolog
• Alternate names: vacuolar protein-sorting-associated protein 25, ELL-associated protein of 20 kDa, ESCRT-II complex subunit VPS25, dermal papilla-derived protein 9,
• Gene location: 17q21.2 (42773448: 42779598)     Exons: 6     NC_000017.11
• Gene summary(Entrez): This gene encodes a protein that is a subunit of the endosomal sorting complex required for transport II (ESCRT-II). This protein complex functions in sorting of ubiquitinated membrane proteins during endocytosis. A pseudogene of this gene is present on c
• OMIM: 601460

Protein Summary

• Protein general information: Q9BRG1  
  • Name: Vacuolar protein sorting associated protein 25 (hVps25) (Dermal papilla derived protein 9) (ELL associated protein of 20 kDa) (ESCRT II complex subunit VPS25)
  • Length: 176  
  • Mass: 20748
  • Tissue specificity: Expressed at the mRNA level in kidney, liver, pancreas, and placenta. Lower levels of expression are found in heart, skeletal muscle, brain and lung. {ECO
• Sequence:

  MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQ
  IVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLL
  RALQALQQEHKAEIITVSDGRGVKFF

• Structural information:
  • Interpro: IPR008570  IPR014041  IPR036388  IPR036390  
  • PDB: 2ZME 3CUQ 3HTU
  • PDBsum: 2ZME 3CUQ 3HTU
  • STRING: ENSP00000253794
• Other Databases: GeneCards:  VPS25  Malacards:  VPS25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036258	multivesicular body assembly	TAS	biological process
GO:0000814	ESCRT II complex	TAS	cellular component
GO:0016236	macroautophagy	TAS	biological process
GO:0005198	structural molecule activity	IBA	molecular function
GO:0042803	protein homodimerization activity	IBA	molecular function
GO:0043328	protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IBA	biological process
GO:0000814	ESCRT II complex	IBA	cellular component
GO:0071985	multivesicular body sorting pathway	IEA	biological process
GO:0000814	ESCRT II complex	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016197	endosomal transport	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0010008	endosome membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0000814	ESCRT II complex	IDA	cellular component
GO:0010008	endosome membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0007175	negative regulation of epidermal growth factor-activated receptor activity	IMP	biological process
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881