• Gene id: 84305

Gene Summary

• Gene Symbol: PYM1   Gene   UCSC   Ensembl
• Aliases: PYM, WIBG
• Gene name: PYM homolog 1, exon junction complex associated factor
• Alternate names: partner of Y14 and mago, protein wibg homolog, within bgcn homolog,
• Gene location: 12q13.2 (55927893: 55901412)     Exons: 4     NC_000012.12

Protein Summary

• Protein general information: Q9BRP8  
  • Name: Partner of Y14 and mago (PYM homolog 1 exon junction complex associated factor) (Protein wibg homolog)
  • Length: 204  
  • Mass: 22656
• Sequence:

  MEAAGSPAATETGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPELPPGLSPEATAPVTPSR
  PEGGEPGLSKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVSLEETAQLPSAPQGSRAAPTAASDQPDSAATTEK
  AKKIKNLKKKLRQVEELQQRIQAGEVSQPSKEQLEKLARRRALEEELEDLELGL

• Structural information:
  • Interpro: IPR039333  IPR015362  IPR036348  
  • DIP: 48413
  • STRING: ENSP00000386156
• Other Databases: GeneCards:  PYM1  Malacards:  PYM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035145	exon-exon junction complex	IBA	cellular component
GO:1903259	exon-exon junction complex disassembly	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0045727	positive regulation of translation	IDA	biological process
GO:0043022	ribosome binding	IDA	molecular function
GO:0043022	ribosome binding	IDA	molecular function
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903259	exon-exon junction complex disassembly	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:1903259	exon-exon junction complex disassembly	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0035145	exon-exon junction complex	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)