• Gene id: 84299

Gene Summary

• Gene Symbol: MIEN1   Gene   UCSC   Ensembl
• Aliases: C17orf37, C35, ORB3, RDX12, XTP4
• Gene name: migration and invasion enhancer 1
• Alternate names: migration and invasion enhancer 1, HBV X-transactivated gene 4 protein, HBV XAg-transactivated protein 4, protein C17orf37,
• Gene location: 17q12 (39730562: 39728499)     Exons: 18     NC_000017.11
• OMIM: 611802

Protein Summary

• Protein general information: Q9BRT3  
  • Name: Migration and invasion enhancer 1 (HBV X transactivated gene 4 protein) (HBV XAg transactivated protein 4) (Protein C35)
  • Length: 115  
  • Mass: 12403
  • Tissue specificity: Among normal tissues, present only in Leydig cells. Strongly up-regulated in breast cancers and in brain cancer distant metastasis (at protein level). Up-regulated in prostate cancer cells and in the higher grades of prostate adenocarc
• Sequence:

  MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVF
  SKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL

• Structural information:
  • Interpro: IPR011893  IPR036249  
  • PDB: 2LJK
  • PDBsum: 2LJK
  • STRING: ENSP00000377778
• Other Databases: GeneCards:  MIEN1  Malacards:  MIEN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043066	negative regulation of apoptotic process	IBA	biological process
GO:0051491	positive regulation of filopodium assembly	IBA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0051491	positive regulation of filopodium assembly	IDA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0031235	intrinsic component of the cytoplasmic side of the plasma membrane	IDA	cellular component
GO:0030335	positive regulation of cell migration	IDA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)