• Gene id: 84294

Gene Summary

• Gene Symbol: UTP23   Gene   UCSC   Ensembl
• Aliases: C8orf53
• Gene name: UTP23 small subunit processome component
• Alternate names: rRNA-processing protein UTP23 homolog, UTP23, small subunit (SSU) processome component, homolog,
• Gene location: 8q24.11 (116766523: 116774683)     Exons: 3     NC_000008.11

Protein Summary

• Protein general information: Q9BRU9  
  • Name: rRNA processing protein UTP23 homolog
  • Length: 249  
  • Mass: 28402
• Sequence:

  MKITRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELETLGKD
  LYGAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSVKVKKKPGVPLMFIIQNTMVLDKP
  SPKTIAFVKAVESGQLVSVHEKESIKHLKEEQGLVKNTEQSRRKKRKKISGPNPLSCLKKKKKAPDTQSSASEKK
  RKRKRIRNRSNPKVLSEKQNAEGE

• Structural information:
  • Interpro: IPR006984  IPR029060  
  • STRING: ENSP00000308332
• Other Databases: GeneCards:  UTP23  Malacards:  UTP23

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032040	small-subunit processome	IBA	cellular component
GO:0005730	nucleolus	IBA	cellular component
GO:0070181	small ribosomal subunit rRNA binding	IBA	molecular function
GO:0032040	small-subunit processome	IEA	cellular component
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0006364	rRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000480	endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
colorectal adenocarcinoma	PMID:26553438
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq