• Gene id: 84293

Gene Summary

• Gene Symbol: PRXL2A   Gene   UCSC   Ensembl
• Aliases: Adrx, C10orf58, FAM213A, PAMM
• Gene name: peroxiredoxin like 2A
• Alternate names: peroxiredoxin-like 2A, Adiporedoxin, UPF0765 protein C10orf58, family with sequence similarity 213 member A, peroxiredoxin (PRX)-like 2 activated in M-CSF stimulated monocytes, peroxiredoxin-like 2 activated in M-CSF stimulated monocytes, redox-regulatory prote,
• Gene location: 10q23.1 (80407828: 80437114)     Exons: 3     NC_000010.11
• OMIM: 617165

Protein Summary

• Protein general information: Q9BRX8  
  • Name: Peroxiredoxin like 2A (Peroxiredoxin like 2 activated in M CSF stimulated monocytes) (Protein PAMM) (Redox regulatory protein FAM213A)
  • Length: 229  
  • Mass: 25764
  • Tissue specificity: Expressed in CSF1 and TNFSF11-stimulated CD14(+) peripheral blood mononuclear cells (PBMCs). {ECO
• Sequence:

  MSFLQDPSFFTMGMWSIGAGALGAAALALLLANTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAKELWEKNGA
  VIMAVRRPGCFLCREEAADLSSLKSMLDQLGVPLYAVVKEHIRTEVKDFQPYFKGEIFLDEKKKFYGPQRRKMMF
  MGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLA
  SEKK

• Structural information:
  • Interpro: IPR032801  
  • STRING: ENSP00000482445
• Other Databases: GeneCards:  PRXL2A  Malacards:  PRXL2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0016209	antioxidant activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0045670	regulation of osteoclast differentiation	IDA	biological process
GO:0016209	antioxidant activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016209	antioxidant activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881