• Gene id: 84289

Gene Summary

• Gene Symbol: ING5   Gene   UCSC   Ensembl
• Aliases: p28ING5
• Gene name: inhibitor of growth family member 5
• Alternate names: inhibitor of growth protein 5,
• Gene location: 2q37.3 (241687016: 241729480)     Exons: 15     NC_000002.12
• Gene summary(Entrez): This gene encodes a tumor suppressor protein that inhibits cell growth and induces apoptosis. This protein contains a PHD-type zinc finger. It interacts with tumor suppressor p53 and p300, a component of the histone acetyl transferase complex, suggesting
• OMIM: 605109

Protein Summary

• Protein general information: Q8WYH8  
  • Name: Inhibitor of growth protein 5 (p28ING5)
  • Length: 240  
  • Mass: 27751
  • Tissue specificity: Down-regulated in bone marrow cells in acute myeloid leukemia patients as compared with normal bone marrow cells. {ECO
• Sequence:

  MATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAEIDILAAEYISTVKTLSPDQRVERLQKIQNAYSKC
  KEYSDDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEE
  DTPKKKKHKGGSEFTDTILSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKG
  KWFCPRCVQEKRKKK

• Structural information:
  • Interpro: IPR028638  IPR028651  IPR024610  IPR019786  IPR011011   IPR001965  IPR019787  IPR013083  
  • Prosite: PS01359 PS50016
  • PDB: 3C6W 5ME8 5MTO
  • PDBsum: 3C6W 5ME8 5MTO
  • DIP: 32511
  • STRING: ENSP00000322142
• Other Databases: GeneCards:  ING5  Malacards:  ING5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IBA	molecular function
GO:0008285	negative regulation of cell population proliferation	IBA	biological process
GO:0035064	methylated histone binding	IBA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:2001235	positive regulation of apoptotic signaling pathway	IBA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0035064	methylated histone binding	IDA	molecular function
GO:0070776	MOZ/MORF histone acetyltransferase complex	IDA	cellular component
GO:0070776	MOZ/MORF histone acetyltransferase complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0043967	histone H4 acetylation	IDA	biological process
GO:0044154	histone H3-K14 acetylation	IDA	biological process
GO:0000123	histone acetyltransferase complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016573	histone acetylation	IEA	biological process
GO:0070776	MOZ/MORF histone acetyltransferase complex	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008285	negative regulation of cell population proliferation	IGI	biological process
GO:0043065	positive regulation of apoptotic process	IGI	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0045926	negative regulation of growth	IDA	biological process
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0006260	DNA replication	IDA	biological process
GO:0006473	protein acetylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq