• Gene id: 84287

Gene Summary

• Gene Symbol: ZDHHC16   Gene   UCSC   Ensembl
• Aliases: APH2, DHHC-16
• Gene name: zinc finger DHHC-type palmitoyltransferase 16
• Alternate names: palmitoyltransferase ZDHHC16, Abl-philin 2, probable palmitoyltransferase ZDHHC16, zinc finger DHHC domain-containing protein 16, zinc finger DHHC-type containing 16, zinc finger, DHHC domain containing 16,
• Gene location: 10q24.1 (97446130: 97457369)     Exons: 12     NC_000010.11
• OMIM: 616750

Protein Summary

• Protein general information: Q969W1  
  • Name: Palmitoyltransferase ZDHHC16 (EC 2.3.1.225) (Abl philin 2) (Zinc finger DHHC domain containing protein 16) (DHHC 16)
  • Length: 377  
  • Mass: 43633
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MRGQRSLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFGGSDTAVDAAFEPVYWLVDNV
  IRWFGVVFVVLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRND
  IATVSICKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREA
  YAAIEKMKQLDKNKLQAVANQTYHQTPPPTFSFRERMTHKSLVYLWFLCSSVALALGALTVWHAVLISRGETSIE
  RHINKKERRRLQAKGRVFRNPYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWEPPPWVTAHSASVM
  AV

• Structural information:
  • Protein Domains: (155..20-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  IPR039859  
  • Prosite: PS50216
  • STRING: ENSP00000377357
• Other Databases: GeneCards:  ZDHHC16  Malacards:  ZDHHC16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0016409	palmitoyltransferase activity	IBA	molecular function
GO:0018345	protein palmitoylation	IBA	biological process
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0021537	telencephalon development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007507	heart development	ISS	biological process
GO:0006974	cellular response to DNA damage stimulus	ISS	biological process
GO:0001654	eye development	ISS	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0018345	protein palmitoylation	IEA	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0007507	heart development	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0001654	eye development	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq