• Gene id: 84284

Gene Summary

• Gene Symbol: NTPCR   Gene   UCSC   Ensembl
• Aliases: C1orf57, HCR-NTPase, THEP1
• Gene name: nucleoside-triphosphatase, cancer-related
• Alternate names: cancer-related nucleoside-triphosphatase, human cancer-related NTPase, nucleoside triphosphate phosphohydrolase, nucleoside-triphosphatase C1orf57,
• Gene location: 1q42.2 (232950610: 232983881)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a non-specific nucleoside triphosphatase that is slow-acting in vitro. This gene is overexpressed in many tumor tissues, and while it is not essential for the cell, overexpression is cytotoxic. However, the cytotoxicity

Protein Summary

• Protein general information: Q9BSD7  
  • Name: Cancer related nucleoside triphosphatase (NTPase) (EC 3.6.1.15) (Nucleoside triphosphate phosphohydrolase)
  • Length: 190  
  • Mass: 20713
• Sequence:

  MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEVRQGGRRIGFDVVTLSGTRGPLSRVGLEPPPGKRE
  CRVGQYVVDLTSFEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAVRQTLSTPGTIILGTIPVPKGK
  PLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQSSRK

• Structural information:
  • Interpro: IPR003593  IPR004948  IPR027417  
  • PDB: 2I3B
  • PDBsum: 2I3B
  • STRING: ENSP00000355587
• Other Databases: GeneCards:  NTPCR  Malacards:  NTPCR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0098519	nucleotide phosphatase activity, acting on free nucleotides	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0017111	nucleoside-triphosphatase activity	IEA	molecular function
GO:0016311	dephosphorylation	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa00730	Thiamine metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray