• Gene id: 84276

Gene Summary

• Gene Symbol: NICN1   Gene   UCSC   Ensembl
• Gene name: nicolin 1
• Alternate names: nicolin-1, NPCEDRG, PGs5, tubulin polyglutamylase complex subunit 5,
• Gene location: 3p21.31 (49429323: 49422332)     Exons: 6     NC_000003.12
• Gene summary(Entrez): This protein encoded by this gene localizes to the nucleus and is expressed in numerous tissues including brain, testis, liver, and kidney. This refseq contains genomic sequence in its 3' UTR which is not supported by experimental evidence. Computer predi
• OMIM: 609694

Protein Summary

• Protein general information: Q9BSH3  
  • Name: Nicolin 1 (NPCEDRG) (Tubulin polyglutamylase complex subunit 5) (PGs5)
  • Length: 213  
  • Mass: 24202
  • Tissue specificity: High expression level is found in brain, testis, liver and kidney. Weak expression in spleen, leukocytes, small intestine and colon. {ECO
• Sequence:

  MSRVLVPCHVKGSVALQVGDVRTSQGRPGVLVIDVTFPSVAPFELQEITFKNYYTAFLSIRVRQYTSAHTPAKWV
  TCLRDYCLMPDPHSEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGPKSPSVTFPKW
  LSHPVPCEQPALLREGLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLLSYT

• Structural information:
  • Interpro: IPR040235  
  • STRING: ENSP00000273598
• Other Databases: GeneCards:  NICN1  Malacards:  NICN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray