• Gene id: 84273

Gene Summary

• Gene Symbol: NOA1   Gene   UCSC   Ensembl
• Aliases: C4orf14, MTG3, hAtNOS1, hNOA1, mAtNOS1
• Gene name: nitric oxide associated 1
• Alternate names: nitric oxide-associated protein 1, mitochondrial GTPase 3 homolog, nitric oxide synthase, mitochondrial (putative), putative ortholog of Arabidopsis mitochondrial nitric oxide synthase,
• Gene location: 4q12 (56977605: 56963349)     Exons: 7     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a nuclear-encoded GTPase that functions in the mitochondrion. Upon translation, this protein is imported into the nucleus and then into the nucleolus before being exported to the mitochondrion. The encoded protein is re
• OMIM: 616102

Protein Summary

• Protein general information: Q8NC60  
  • Name: Nitric oxide associated protein 1
  • Length: 698  
  • Mass: 78458
• Sequence:

  MLPARLPFRLLSLFLRGSAPTAARHGLREPLLERRCAAASSFQHSSSLGRELPYDPVDTEGFGEGGDMQERFLFP
  EYILDPEPQPTREKQLQELQQQQEEEERQRQQRREERRQQNLRARSREHPVVGHPDPALPPSGVNCSGCGAELHC
  QDAGVPGYLPREKFLRTAEADGGLARTVCQRCWLLSHHRRALRLQVSREQYLELVSAALRRPGPSLVLYMVDLLD
  LPDALLPDLPALVGPKQLIVLGNKVDLLPQDAPGYRQRLRERLWEDCARAGLLLAPGHQGPQRPVKDEPQDGENP
  NPPNWSRTVVRDVRLISAKTGYGVEELISALQRSWRYRGDVYLVGATNAGKSTLFNTLLESDYCTAKGSEAIDRA
  TISPWPGTTLNLLKFPICNPTPYRMFKRHQRLKKDSTQAEEDLSEQEQNQLNVLKKHGYVVGRVGRTFLYSEEQK
  DNIPFEFDADSLAFDMENDPVMGTHKSTKQVELTAQDVKDAHWFYDTPGITKENCILNLLTEKEVNIVLPTQSIV
  PRTFVLKPGMVLFLGAIGRIDFLQGNQSAWFTVVASNILPVHITSLDRADALYQKHAGHTLLQIPMGGKERMAGF
  PPLVAEDIMLKEGLGASEAVADIKFSSAGWVSVTPNFKDRLHLRGYTPEGTVLTVRPPLLPYIVNIKGQRIKKSV
  AYKTKKPPSLMYNVRKKKGKINV

• Structural information:
  • Protein Domains: (202..50-)
    (/note="CP-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01058"-)
  • Interpro: IPR030378  IPR006073  IPR027417  
  • Prosite: PS51721
  • STRING: ENSP00000264230
• Other Databases: GeneCards:  NOA1  Malacards:  NOA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032543	mitochondrial translation	IEA	biological process
GO:0010941	regulation of cell death	IEA	biological process
GO:0043457	regulation of cellular respiration	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0031314	extrinsic component of mitochondrial inner membrane	IDA	colocalizes with
GO:0005525	GTP binding	IDA	molecular function
GO:0043457	regulation of cellular respiration	IMP	biological process
GO:0010941	regulation of cell death	IMP	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032543	mitochondrial translation	ISS	biological process

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray