• Gene id: 84271

Gene Summary

• Gene Symbol: POLDIP3   Gene   UCSC   Ensembl
• Aliases: PDIP3, PDIP46, SKAR
• Gene name: DNA polymerase delta interacting protein 3
• Alternate names: polymerase delta-interacting protein 3, 46 kDa DNA polymerase delta interaction protein, RNA-binding protein P46, S6K1 Aly/REF-like target, polymerase (DNA) delta interacting protein 3, polymerase (DNA-directed), delta interacting protein 3,
• Gene location: 22q13.2 (42614961: 42583720)     Exons: 26     NC_000022.11
• Gene summary(Entrez): This gene encodes an RRM (RNA recognition motif)-containing protein that participates in the regulation of translation by recruiting ribosomal protein S6 kinase beta-1 to mRNAs. Alternative splicing results in multiple transcript variants. [provided by Re
• OMIM: 611520

Protein Summary

• Protein general information: Q9BY77  
  • Name: Polymerase delta interacting protein 3 (46 kDa DNA polymerase delta interaction protein) (p46) (S6K1 Aly/REF like target) (SKAR)
  • Length: 421  
  • Mass: 46089
• Sequence:

  MADISLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATFQQRFDARQKIGLSDARLKLGVKDAR
  EKLLQKDARFRIKGKVQDAREMLNSRKQQTTVPQKPRQVADAREKISLKRSSPAAFINPPIGTVTPALKLTKTIQ
  VPQQKAMAPLHPHPAGMRINVVNNHQAKQNLYDLDEDDDGIASVPTKQMKFAASGGFLHHMAGLSSSKLSMSKAL
  PLTKVVQNDAYTAPALPSSIRTKALTNMSRTLVNKEEPPKELPAAEPVLSPLEGTKMTVNNLHPRVTEEDIVELF
  CVCGALKRARLVHPGVAEVVFVKKDDAITAYKKYNNRCLDGQPMKCNLHMNGNVITSDQPILLRLSDSPSMKKES
  ELPRRVNSASSSNPPAEVDPDTILKALFKSSGASVTTQPTEFKIKL

• Structural information:
  • Protein Domains: (280..35-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR034784  IPR035979  IPR000504  
  • Prosite: PS50102
  • CDD: cd12681
  • STRING: ENSP00000397927
• Other Databases: GeneCards:  POLDIP3  Malacards:  POLDIP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016973	poly(A)+ mRNA export from nucleus	IDA	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006405	RNA export from nucleus	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:0016607	nuclear speck	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0045727	positive regulation of translation	IMP	biological process
GO:0044877	protein-containing complex binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)