• Gene id: 84270

Gene Summary

• Gene Symbol: CARD19   Gene   UCSC   Ensembl
• Aliases: BinCARD, C9orf89
• Gene name: caspase recruitment domain family member 19
• Alternate names: caspase recruitment domain-containing protein 19, Bcl10-interacting protein with CARD, bcl10-interacting CARD protein,
• Gene location: 9q22.31 (93096216: 93113282)     Exons: 7     NC_000009.12
• OMIM: 617726

Protein Summary

• Protein general information: Q96LW7  
  • Name: Caspase recruitment domain containing protein 19 (Bcl10 interacting CARD protein) (BinCARD)
  • Length: 228  
  • Mass: 25589
  • Tissue specificity: Expressed in ovary, testis, placenta, skeletal muscle, kidney, lung, heart and liver (at protein level). Expressed in thymus and brain. {ECO
• Sequence:

  MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGER
  DCQEFYRALYIHAQPLHSRLPSRHALRKFHITNHACLVLARGGHPSLPLMAWMSSMTTQVCCSPGLASPLASAPP
  QRPPSGPEGRVWQAQAVQMLVSVSHFLPLPPSLSHGSFHTAWGILYVHSCPSFSNLIPRGSLHVCVDSNLVPTAA
  WRS

• Structural information:
  • Protein Domains: (8..9-)
    (/note="CARD"-)
  • Interpro: IPR042146  
  • CDD: cd13785
  • PDB: 4DWN 4FH0
  • PDBsum: 4DWN 4FH0
• Other Databases: GeneCards:  CARD19  Malacards:  CARD19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005634	nucleus	NAS	cellular component
GO:0050700	CARD domain binding	NAS	molecular function
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	NAS	biological process
GO:0005829	cytosol	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881