• Gene id: 84265

Gene Summary

• Gene Symbol: POLR3GL   Gene   UCSC   Ensembl
• Aliases: RPC32HOM, flj32422
• Gene name: RNA polymerase III subunit GL
• Alternate names: DNA-directed RNA polymerase III subunit RPC7-like, DNA-directed RNA polymerase III subunit G-like, RNA polymerase III 32 kDa beta subunit, RNA polymerase III subunit C7-like, RNA polymerase III subunit G like, RPC32-beta, RPC32-like protein, alternative RNA poly,
• Gene location: 1q21.1 (145959036: 145978847)     Exons: 9     NC_000001.11
• OMIM: 601464

Protein Summary

• Protein general information: Q9BT43  
  • Name: DNA directed RNA polymerase III subunit RPC7 like (RNA polymerase III subunit C7 like) (DNA directed RNA polymerase III subunit G like) (RNA polymerase III 32 kDa beta subunit) (RPC32 beta)
  • Length: 218  
  • Mass: 25334
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MASRGGGRGRGRGQLTFNVEAVGIGKGDALPPPTLQPSPLFPPLEFRPVPLPSGEEGEYVLALKQELRGAMRQLP
  YFIRPAVPKRDVERYSDKYQMSGPIDNAIDWNPDWRRLPRELKIRVRKLQKERITILLPKRPPKTTEDKEETIQK
  LETLEKKEEEVTSEEDEEKEEEEEKEEEEEEEYDEEEHEEETDYIMSYFDNGEDFGGDSDDNMDEAIY

• Structural information:
  • Interpro: IPR024661  
  • PDB: 5AFQ
  • PDBsum: 5AFQ
  • DIP: 59080
  • STRING: ENSP00000358320
• Other Databases: GeneCards:  POLR3GL  Malacards:  POLR3GL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	IBA	colocalizes with
GO:0005666	RNA polymerase III complex	IBA	cellular component
GO:0006383	transcription by RNA polymerase III	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006383	transcription by RNA polymerase III	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005666	RNA polymerase III complex	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	colocalizes with
GO:0032481	positive regulation of type I interferon production	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04623	Cytosolic DNA-sensing pathway
hsa03020	RNA polymerase

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881