• Gene id: 84261

Gene Summary

• Gene Symbol: FBXW9   Gene   UCSC   Ensembl
• Aliases: Fbw9, MEC-15
• Gene name: F-box and WD repeat domain containing 9
• Alternate names: F-box/WD repeat-containing protein 9, F-box and WD-40 domain protein 9, F-box and WD-40 domain-containing protein 9, F-box and WD-40 repeat containing protein 9, specificity factor for SCF ubiquitin ligase,
• Gene location: 19p13.13 (12696899: 12688915)     Exons: 10     NC_000019.10
• Gene summary(Entrez): Members of the F-box protein family, such as FBXW9, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box pro
• OMIM: 611348

Protein Summary

• Protein general information: Q5XUX1  
  • Name: F box/WD repeat containing protein 9 (F box and WD 40 domain containing protein 9)
  • Length: 488  
  • Mass: 54115
• Sequence:

  MELPLGRCDDSRTWDDDSDPESETDPDAQAKAYVARVLSPPKSGLAFSRPSQLSTPAASPSASEPRAASRVSAVS
  EPGLLSLPPELLLEICSYLDARLVLHVLSRVCHALRDLVSDHVTWRLRALRRVRAPYPVVEEKNFDWPAACIALE
  QHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESNQVLIKTLGTKRNSTH
  EGWVWSLAAQDHRVCSGSWDSTVKLWDMAADGQQFGEIKASSAVLCLSYLPDILVTGTYDKKVTIYDPRDRMETR
  DALMGWGGPSRGSDIPPHRPITHEAGPALLKHQQLHSRPVLTLLADDRHIISGSEDHTLVVVDRRANSVLQRLQL
  DSYLLCMSYQEPQLWAGDNQGLLHVFANRNGCFQLIRSFDVGHSFPITGIQYSVGALYTTSTDKTIRVHVPTDPP
  RTICTRRHDNGLNRVCAEGNLVVAGSGDLSLEVWRLQA

• Structural information:
  • Protein Domains: (76..12-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080"-)
  • Interpro: IPR036047  IPR001810  IPR020472  IPR015943  IPR001680   IPR019775  IPR017986  IPR036322  
  • Prosite: PS50181 PS00678 PS50082 PS50294
  • STRING: ENSP00000376945
• Other Databases: GeneCards:  FBXW9  Malacards:  FBXW9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030687	preribosome, large subunit precursor	IBA	cellular component
GO:0000209	protein polyubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq