About Us

Search Result


Gene id 84260
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol TCHP   Gene   UCSC   Ensembl
Aliases TpMs
Gene name trichoplein keratin filament binding
Alternate names trichoplein keratin filament-binding protein, mitochondrial protein with oncostatic activity, mitostatin, tumor suppressor protein,
Gene location 12q24.11 (109880666: 109918068)     Exons: 15     NC_000012.12
OMIM 612654

Protein Summary

Protein general information Q9BT92  

Name: Trichoplein keratin filament binding protein (Protein TCHP) (Mitochondrial protein with oncostatic activity) (Mitostatin) (Tumor suppressor protein)

Length: 498  Mass: 61072

Tissue specificity: Expressed at high levels in normal urothelial and breast epithelial cells. Also expressed in the smooth muscle and endothelial cells. Reduced expression seen in advanced bladder and breast carcinomas (at protein level). Ubiquitous. Exp

Sequence MALPTLPSYWCSQQRLNQQLARQREQEARLRQQWEQNSRYFRMSDICSSKQAEWSSKTSYQRSMHAYQREKMKEE
KRRSLEARREKLRQLMQEEQDLLARELEELRLSMNLQERRIREQHGKLKSAKEEQRKLIAEQLLYEHWKKNNPKL
REMELDLHQKHVVNSWEMQKEEKKQQEATAEQENKRYENEYERARREALERMKAEEERRQLEDKLQAEALLQQME
ELKLKEVEATKLKKEQENLLKQRWELERLEEERKQMEAFRQKAELGRFLRHQYNAQLSRRTQQIQEELEADRRIL
QALLEKEDESQRLHLARREQVMADVAWMKQAIEEQLQLERAREAELQMLLREEAKEMWEKREAEWARERSARDRL
MSEVLTGRQQQIQEKIEQNRRAQEESLKHREQLIRNLEEVRELARREKEESEKLKSARKQELEAQVAERRLQAWE
ADQQEEEEEEEARRVEQLSDALLQQEAETMAEQGYRPKPYGHPKIAWN
Structural information
Interpro:  IPR026773  
MINT:  
STRING:   ENSP00000324404
Other Databases GeneCards:  TCHP  Malacards:  TCHP

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0045095 keratin filament
IDA cellular component
GO:0045179 apical cortex
IDA cellular component
GO:0006915 apoptotic process
IBA biological process
GO:0045095 keratin filament
IBA cellular component
GO:0030308 negative regulation of ce
ll growth
IDA biological process
GO:0005813 centrosome
IDA cellular component
GO:0006915 apoptotic process
IDA biological process
GO:0005886 plasma membrane
IDA cellular component
GO:0005739 mitochondrion
IDA cellular component
GO:0005737 cytoplasm
IDA cellular component
GO:1902018 negative regulation of ci
lium assembly
IMP biological process
GO:0005515 protein binding
IPI molecular function
GO:0030054 cell junction
IEA cellular component
GO:0030030 cell projection organizat
ion
IEA biological process
GO:0005886 plasma membrane
IEA cellular component
GO:0005739 mitochondrion
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0006915 apoptotic process
IEA biological process
GO:0016020 membrane
IEA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0097539 ciliary transition fiber
IEA cellular component
GO:0030057 desmosome
IEA cellular component
GO:0045095 keratin filament
IEA cellular component
GO:0030057 desmosome
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0005856 cytoskeleton
IEA cellular component
GO:0005886 plasma membrane
IEA cellular component
GO:0005739 mitochondrion
IEA cellular component
GO:0005886 plasma membrane
IDA cellular component
GO:0005813 centrosome
IDA cellular component
GO:0005829 cytosol
IDA cellular component
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract