• Gene id: 84251

Gene Summary

• Gene Symbol: SGIP1   Gene   UCSC   Ensembl
• Gene name: SH3GL interacting endocytic adaptor 1
• Alternate names: SH3-containing GRB2-like protein 3-interacting protein 1, SH3 domain GRB2 like endophilin interacting protein 1, endophilin-3-interacting protein,
• Gene location: 1p31.3 (66533360: 66751138)     Exons: 30     NC_000001.11
• Gene summary(Entrez): SGIP1 functions as an endocytic protein that affects signaling by receptors in neuronal systems involved in energy homeostasis via its interaction with endophilins (see SH3GL3; MIM 603362) (Trevaskis et al., 2005 [PubMed 15919751] and Uezu et al., 2007 [P

Protein Summary

• Protein general information: Q9BQI5  
  • Name: SH3 containing GRB2 like protein 3 interacting protein 1 (Endophilin 3 interacting protein)
  • Length: 828  
  • Mass: 89109
  • Tissue specificity: Specifically expressed in brain. {ECO
• Sequence:

  MMEGLKKRTRKAFGIRKKEKDTDSTGSPDRDGIQPSPHEPPYNSKAECAREGGKKVSKKSNGAPNGFYAEIDWER
  YNSPELDEEGYSIRPEEPGSTKGKHFYSSSESEEEEESHKKFNIKIKPLQSKDILKNAATVDELKASIGNIALSP
  SPVRKSPRRSPGAIKRNLSSEEVARPRRSTPTPELISKKPPDDTTALAPLFGPPLESAFDEQKTEVLLDQPEIWG
  SGQPINPSMESPKLTRPFPTGTPPPLPPKNVPATPPRTGSPLTIGPGNDQSATEVKIEKLPSINDLDSIFGPVLS
  PKSVAVNAEEKWVHFSDTSPEHVTPELTPREKVVSPPATPDNPADSPAPGPLGPPGPTGPPGPPGPPRNVLSPLN
  LEEVQKKVAEQTFIKDDYLETISSPKDFGLGQRATPPPPPPPTYRTVVSSPGPGSGPGPGTTSGASSPARPATPL
  VPCRSTTPPPPPPRPPSRPKLPPGKPGVGDVSRPFSPPIHSSSPPPIAPLARAESTSSISSTNSLSAATTPTVEN
  EQPSLVWFDRGKFYLTFEGSSRGPSPLTMGAQDTLPVAAAFTETVNAYFKGADPSKCIVKITGEMVLSFPAGITR
  HFANNPSPAALTFRVINFSRLEHVLPNPQLLCCDNTQNDANTKEFWVNMPNLMTHLKKVSEQKPQATYYNVDMLK
  YQVSAQGIQSTPLNLAVNWRCEPSSTDLRIDYKYNTDAMTTAVALNNVQFLVPIDGGVTKLQAVLPPAVWNAEQQ
  RILWKIPDISQKSENGGVGSLLARFQLSEGPSKPSPLVVQFTSEGSTLSGCDIELVGAGYRFSLIKKRFAAGKYL
  ADN

• Structural information:
  • Protein Domains: (559..82-)
    (/note="MHD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00404"-)
  • Interpro: IPR036168  IPR028565  IPR018808  IPR037984  
  • Prosite: PS51072
  • CDD: cd09266
  • PDB: 5AWR 5AWS 5AWT 5AWU 6A9Y
  • PDBsum: 5AWR 5AWS 5AWT 5AWU 6A9Y
  • STRING: ENSP00000360076
• Other Databases: GeneCards:  SGIP1  Malacards:  SGIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005905	clathrin-coated pit	IBA	cellular component
GO:0008092	cytoskeletal protein binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005856	cytoskeleton	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0030136	clathrin-coated vesicle	IBA	cellular component
GO:0048268	clathrin coat assembly	IBA	biological process
GO:0072583	clathrin-dependent endocytosis	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0072583	clathrin-dependent endocytosis	IEA	biological process
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0048260	positive regulation of receptor-mediated endocytosis	IEA	biological process
GO:0030122	AP-2 adaptor complex	IEA	cellular component
GO:0015631	tubulin binding	IEA	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0030136	clathrin-coated vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005543	phospholipid binding	IEA	molecular function
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005905	clathrin-coated pit	IDA	cellular component
GO:0097009	energy homeostasis	ISS	biological process
GO:0005543	phospholipid binding	ISS	molecular function
GO:0030122	AP-2 adaptor complex	ISS	cellular component
GO:2000253	positive regulation of feeding behavior	ISS	biological process
GO:0030136	clathrin-coated vesicle	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002021	response to dietary excess	ISS	biological process
GO:0048260	positive regulation of receptor-mediated endocytosis	ISS	biological process
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0008017	microtubule binding	ISS	molecular function

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray