• Gene id: 84246

Gene Summary

• Gene Symbol: MED10   Gene   UCSC   Ensembl
• Aliases: L6, NUT2, TRG20
• Gene name: mediator complex subunit 10
• Alternate names: mediator of RNA polymerase II transcription subunit 10, TRG-17, TRG-20, mediator of RNA polymerase II transcription, subunit 10, transformation-related gene 17 protein, transformation-related gene 20 protein,
• Gene location: 5p15.31 (224434639: 224740553)     Exons: 13     NC_000001.11
• Gene summary(Entrez): MED10 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]).[supplied by OMIM, Oct 2008]
• OMIM: 612382

Protein Summary

• Protein general information: Q9BTT4  
  • Name: Mediator of RNA polymerase II transcription subunit 10 (Mediator complex subunit 10) (Transformation related gene 17 protein) (TRG 17) (Transformation related gene 20 protein) (TRG 20)
  • Length: 135  
  • Mass: 15688
• Sequence:

  MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLNQKLNFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGR
  NPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS

• Structural information:
  • Interpro: IPR019145  
  • DIP: 31457
  • STRING: ENSP00000255764
• Other Databases: GeneCards:  MED10  Malacards:  MED10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0016592	mediator complex	IBA	cellular component
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0016592	mediator complex	IEA	cellular component
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016592	mediator complex	IEA	cellular component
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0000151	ubiquitin ligase complex	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)