• Gene id: 84245

Gene Summary

• Gene Symbol: MRI1   Gene   UCSC   Ensembl
• Aliases: M1Pi, MRDI, MTNA, Ypr118w
• Gene name: methylthioribose-1-phosphate isomerase 1
• Alternate names: methylthioribose-1-phosphate isomerase, MTR-1-P isomerase, S-methyl-5-thioribose-1-phosphate isomerase 1, mediator of RhoA-dependent invasion, methylthioribose-1-phosphate isomerase homolog, translation initiation factor eIF-2B subunit alpha/beta/delta-like pr,
• Gene location: 19p13.13 (13764491: 13774281)     Exons: 7     NC_000019.10
• Gene summary(Entrez): This enzyme functions in the methionine salvage pathway by catalyzing the interconversion of methylthioribose-1-phosphate and methythioribulose-1-phosphate. Elevated expression of the encoded protein is associated with metastatic melanoma and this protein
• OMIM: 615105

Protein Summary

• Protein general information: Q9BV20  
  • Name: Methylthioribose 1 phosphate isomerase (M1Pi) (MTR 1 P isomerase) (EC 5.3.1.23) (Mediator of RhoA dependent invasion) (S methyl 5 thioribose 1 phosphate isomerase) (Translation initiation factor eIF 2B subunit alpha/beta/delta like protein)
  • Length: 369  
  • Mass: 39150
• Sequence:

  MTLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLAVELQAGAGGPGLAAL
  VAFVRDKLSFLVTARPTAVNMARAARDLADVAAREAEREGATEEAVRERVICCTEDMLEKDLRDNRSIGDLGARH
  LLERVAPSGGKVTVLTHCNTGALATAGYGTALGVIRSLHSLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATL
  ITDSMVAAAMAHRGVSAVVVGADRVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEER
  PGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELRTALTTTISSRDGTLDGPQM

• Structural information:
  • Interpro: IPR000649  IPR005251  IPR042529  IPR011559  IPR027363   IPR037171  
  • PDB: 4LDQ 4LDR
  • PDBsum: 4LDQ 4LDR
  • STRING: ENSP00000040663
• Other Databases: GeneCards:  MRI1  Malacards:  MRI1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046523	S-methyl-5-thioribose-1-phosphate isomerase activity	IBA	molecular function
GO:0019509	L-methionine salvage from methylthioadenosine	IBA	biological process
GO:0044237	cellular metabolic process	IEA	biological process
GO:0044249	cellular biosynthetic process	IEA	biological process
GO:0008652	cellular amino acid biosynthetic process	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016853	isomerase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0009086	methionine biosynthetic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0046523	S-methyl-5-thioribose-1-phosphate isomerase activity	IEA	molecular function
GO:0019509	L-methionine salvage from methylthioadenosine	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0046523	S-methyl-5-thioribose-1-phosphate isomerase activity	TAS	molecular function
GO:0046523	S-methyl-5-thioribose-1-phosphate isomerase activity	TAS	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0019284	L-methionine salvage from S-adenosylmethionine	IEA	biological process
GO:0046523	S-methyl-5-thioribose-1-phosphate isomerase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0019509	L-methionine salvage from methylthioadenosine	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00270	Cysteine and methionine metabolism

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R