• Gene id: 84243

Gene Summary

• Gene Symbol: ZDHHC18   Gene   UCSC   Ensembl
• Aliases: DHHC-18, DHHC18
• Gene name: zinc finger DHHC-type palmitoyltransferase 18
• Alternate names: palmitoyltransferase ZDHHC18, zinc finger DHHC domain-containing protein 18, zinc finger DHHC-type containing 18, zinc finger, DHHC domain containing 18,
• Gene location: 1p36.11 (26826687: 26857603)     Exons: 8     NC_000001.11
• OMIM: 604118

Protein Summary

• Protein general information: Q9NUE0  
  • Name: Palmitoyltransferase ZDHHC18 (EC 2.3.1.225) (Zinc finger DHHC domain containing protein 18) (DHHC 18)
  • Length: 388  
  • Mass: 42031
• Sequence:

  MKDCEYQQISPGAAPLPASPGARRPGPAASPTPGPGPAPPAAPAPPRWSSSGSGSGSGSGSLGRRPRRKWEVFPG
  RNRFYCGGRLMLAGHGGVFALTLLLILTTTGLFFVFDCPYLARKLTLAIPIIAAILFFFVMSCLLQTSFTDPGIL
  PRATVCEAAALEKQIDNTGSSTYRPPPRTREVLINGQMVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWV
  GNCVGRRNYRFFYAFILSLSFLTAFIFACVVTHLTLRAQGSNFLSTLKETPASVLELVICFFSIWSILGLSGFHT
  YLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSIITNCCAVLCGPLPPSLIDRRGFVQSDTVLPSPIRSDEPAC
  RAKPDASMVGGHP

• Structural information:
  • Protein Domains: (192..24-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
  • STRING: ENSP00000363257
• Other Databases: GeneCards:  ZDHHC18  Malacards:  ZDHHC18

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0034613	cellular protein localization	IEA	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0018345	protein palmitoylation	IDA	biological process
GO:0016409	palmitoyltransferase activity	IDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq