• Gene id: 84231

Gene Summary

• Gene Symbol: TRAF7   Gene   UCSC   Ensembl
• Aliases: CAFDADD, RFWD1, RNF119
• Gene name: TNF receptor associated factor 7
• Alternate names: E3 ubiquitin-protein ligase TRAF7, RING finger and WD repeat-containing protein 1, RING finger protein 119, RING-type E3 ubiquitin transferase TRAF7, TNF receptor-associated factor 7, E3 ubiquitin protein ligase, ring finger and WD repeat domain 1,
• Gene location: 16p13.3 (2155777: 2178128)     Exons: 21     NC_000016.10
• Gene summary(Entrez): Tumor necrosis factor (TNF; see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc
• OMIM: 606692

Protein Summary

• Protein general information: Q6Q0C0  
  • Name: E3 ubiquitin protein ligase TRAF7 (EC 2.3.2.27) (RING finger and WD repeat containing protein 1) (RING finger protein 119) (RING type E3 ubiquitin transferase TRAF7) (TNF receptor associated factor 7)
  • Length: 670  
  • Mass: 74609
  • Tissue specificity: Ubiquitously expressed with high levels in skeletal muscle, heart, colon, spleen, kidney, liver and placenta. {ECO
• Sequence:

  MSSGKSARYNRFSGGPSNLPTPDVTTGTRMETTFGPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEED
  SMPPISTPRRSDSAISVRSLHSESSMSLRSTFSLPEEEEEPEPLVFAEQPSVKLCCQLCCSVFKDPVITTCGHTF
  CRRCALKSEKCPVDNVKLTVVVNNIAVAEQIGELFIHCRHGCRVAGSGKPPIFEVDPRGCPFTIKLSARKDHEGS
  CDYRPVRCPNNPSCPPLLRMNLEAHLKECEHIKCPHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHE
  MHVALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASMLNDELSHINARLNMG
  ILGSYDPQQIFKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDTCTTYKCQKTLEGHDGIVLALCIQGC
  KLYSGSADCTIIVWDIQNLQKVNTIRAHDNPVCTLVSSHNVLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRA
  LVAAQSYLYSGSYQTIKIWDIRTLDCIHVLQTSGGSVYSIAVTNHHIVCGTYENLIHVWDIESKEQVRTLTGHVG
  TVYALAVISTPDQTKVFSASYDRSLRVWSMDNMICTQTLLRHQGSVTALAVSRGRLFSGAVDSTVKVWTC

• Structural information:
  • Interpro: IPR020472  IPR008974  IPR015943  IPR001680  IPR019775   IPR017986  IPR036322  IPR027370  IPR001841  IPR013083  IPR017907  IPR001293  
  • Prosite: PS00678 PS50082 PS50294 PS00518 PS50089 PS50145
  • STRING: ENSP00000318944
• Other Databases: GeneCards:  TRAF7  Malacards:  TRAF7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070372	regulation of ERK1 and ERK2 cascade	IMP	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016567	protein ubiquitination	IDA	biological process
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0000185	activation of MAPKKK activity	IDA	biological process
GO:2001235	positive regulation of apoptotic signaling pathway	IMP	biological process
GO:0008270	zinc ion binding	NAS	molecular function

Diseases

Associated diseases	References
Meningioma	KEGG:H01556
Meningioma	KEGG:H01556
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray