• Gene id: 84225

Gene Summary

• Gene Symbol: ZMYND15   Gene   UCSC   Ensembl
• Aliases: SPGF14
• Gene name: zinc finger MYND-type containing 15
• Alternate names: zinc finger MYND domain-containing protein 15,
• Gene location: 17p13.2 (4740014: 4746118)     Exons: 14     NC_000017.11
• Gene summary(Entrez): This gene encodes a MYND-containing zinc-binding protein with a nuclear localization sequence. A similar gene in mice has been shown to act as a testis-specific transcriptional repressor by recruiting histone deacetylase enzymes to regulate spatiotemporal
• OMIM: 614312

SNPs

rs587777432

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000017.11   g.4744210_4744213AACA[1]
NC_000017.10   g.4647505_4647508AACA[1]
NG_034160.1   g.9196_9199AACA[1]
NM_001136046.3   c.1516_1519AACA[1]
NM_001136046.2   c.1516_1519AACA[1]
NM_032265.2   c.1399_1402AACA[1]
NM_001267822.1   c.1516_1519AACA[1]
XM_0170252  

Protein Summary

• Protein general information: Q9H091  
  • Name: Zinc finger MYND domain containing protein 15
  • Length: 742  
  • Mass: 81,860
• Sequence:

  MEFVSGYRDEFLDFTALLFGWFRKFVAERGAVGTSLEGRCRQLEAQIRRLPQDPALWVLHVLPNHSVGISLGQGA
  EPGPGPGLGTAWLLGDNPPLHLRDLSPYISFVSLEDGEEGEEEEEEDEEEEKREDGGAGSTEKVEPEEDRELAPT
  SRESPQETNPPGESEEAAREAGGGKDGCREDRVENETRPQKRKGQRSEAAPLHVSCLLLVTDEHGTILGIDLLVD
  GAQGTASWGSGTKDLAPWAYALLCHSMACPMGSGDPRKPRQLTVGDARLHRELESLVPRLGVKLAKTPMRTWGPR
  PGFTFASLRARTCHVCHRHSFEAKLTPCPQCSAVLYCGEACLRADWQRCPDDVSHRFWCPRLAAFMERAGELATL
  PFTYTAEVTSETFNKEAFLASRGLTRGYWTQLSMLIPGPGFSRHPRGNTPSLSLLRGGDPYQLLQGDGTALMPPV
  PPHPPRGVFGSWQDYYTWRGLSLDSPIAVLLTYPLTVYYVITHLVPQSFPELNIQNKQSLKIHVVEAGKEFDLVM
  VFWELLVLLPHVALELQFVGDGLPPESDEQHFTLQRDSLEVSVRPGSGISARPSSGTKEKGGRRDLQIKVSARPY
  HLFQGPKPDLVIGFNSGFALKDTWLRSLPRLQSLRVPAFFTESSEYSCVMDGQTMAVATGGGTSPPQPNPFRSPF
  RLRAADNCMSWYCNAFIFHLVYKPAQGSGARPAPGPPPPSPTPSAPPAPTRRRRGEKKPGRGARRRK

• Structural information:
  • Interpro: IPR002893  
  • Prosite: PS50865
• Other Databases: GeneCards:  ZMYND15  Malacards:  ZMYND15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007286	spermatid development	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function

Diseases

Associated diseases	References
Azoospermia	MIK: 24431330
Maturation arrest	MIK: 24431330
Oligozoospermia	MIK: 24431330
Spermatogenesis defects	OMIM: 614312
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 24431330
Oligozoospermia	MIK: 24431330
Spermatogenic defects	MIK: 24431330
Cryptorchidism	MIK: 28606200
Non obstructive azoospermia	MIK: 24012201
Transcriptional repressor essential for sperm production and male fertility	MIK: 20675388

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24431330	Azoospermia, Oligozoospermia, maturation arrest	TAF4B (p.R611X), ZMYND15 (p.K507Sfs*3 )		7 (Family1: 3 azoospermic brothers, 1 oligozoospermic brother; Family2: 3 azoospermic broters)	Male infertility
20675388	Transcriptional repressor essential for sperm production and male fertility				Male infertility
29713536	Sperm number defects	c.1520_1523delAACA (p.Lys507Serfs*3)			Male infertility	NGS
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R