• Gene id: 84219

Gene Summary

• Gene Symbol: WDR24   Gene   UCSC   Ensembl
• Aliases: C16orf21, JFP7
• Gene name: WD repeat domain 24
• Alternate names: GATOR complex protein WDR24, WD repeat-containing protein 24,
• Gene location: 16p13.3 (690660: 684621)     Exons: 10     NC_000016.10
• OMIM: 601546

Protein Summary

• Protein general information: Q96S15  
  • Name: GATOR complex protein WDR24 (WD repeat containing protein 24)
  • Length: 790  
  • Mass: 88207
• Sequence:

  MEKMSRVTTALGGSVLTGRTMHCHLDAPANAISVCRDAAQVVVAGRSIFKIYAIEEEQFVEKLNLRVGRKPSLNL
  SCADVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCFDL
  RRKDSVSTFSGQSESVRDVQFSIRDYFTFASTFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPEDRGWLAT
  GGRDKMVKVWDMTTHRAKEMHCVQTIASVARVKWRPECRHHLATCSMMVDHNIYVWDVRRPFVPAAMFEEHRDVT
  TGIAWRHPHDPSFLLSGSKDSSLCQHLFRDASQPVERANPEGLCYGLFGDLAFAAKESLVAAESGRKPYTGDRRH
  PIFFKRKLDPAEPFAGLASSALSVFETEPGGGGMRWFVDTAERYALAGRPLAELCDHNAKVARELGRNQVAQTWT
  MLRIIYCSPGLVPTANLNHSVGKGGSCGLPLMNSFNLKDMAPGLGSETRLDRSKGDARSDTVLLDSSATLITNED
  NEETEGSDVPADYLLGDVEGEEDELYLLDPEHAHPEDPECVLPQEAFPLRHEIVDTPPGPEHLQDKADSPHVSGS
  EADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDMLHFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEH
  WYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQASTTLHVNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVV
  KGLFVWCQGCSHGGHLQHIMKWLEGSSHCPAGCGHLCEYS

• Structural information:
  • Interpro: IPR015943  IPR001680  IPR019775  IPR017986  IPR036322   IPR037590  
  • Prosite: PS00678 PS50082 PS50294
  • DIP: 53812
  • STRING: ENSP00000293883
• Other Databases: GeneCards:  WDR24  Malacards:  WDR24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0032008	positive regulation of TOR signaling	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0032008	positive regulation of TOR signaling	IMP	biological process
GO:0061700	GATOR2 complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0034198	cellular response to amino acid starvation	IMP	biological process
GO:0010506	regulation of autophagy	IMP	biological process
GO:0032008	positive regulation of TOR signaling	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04150	mTOR signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq