• Gene id: 84206

Gene Summary

• Gene Symbol: MEX3B   Gene   UCSC   Ensembl
• Aliases: MEX-3B, RKHD3, RNF195
• Gene name: mex-3 RNA binding family member B
• Alternate names: RNA-binding protein MEX3B, RING finger protein 195, ring finger and KH domain containing 3,
• Gene location: 15q25.2 (82046017: 82041777)     Exons: 2     NC_000015.10
• Gene summary(Entrez): This gene encodes an RNA-binding phosphoprotein that is part of the MEX3 (muscle excess 3) family of translational regulators. The encoded protein contains N-terminal nuclear export and nuclear localization signals and is exported from the cytoplasm to th
• OMIM: 612605

Protein Summary

• Protein general information: Q6ZN04  
  • Name: RNA binding protein MEX3B (RING finger and KH domain containing protein 3) (RING finger protein 195)
  • Length: 569  
  • Mass: 58832
  • Tissue specificity: Highest levels found in fetal brain and testis. Detected in the adult intestinal epithelium, specifically in goblet cell at protein level. {ECO
• Sequence:

  MPSSLFADLERNGSGGGGGGSSGGGETLDDQRALQLALDQLSLLGLDSDEGASLYDSEPRKKSVNMTECVPVPSS
  EHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRASRNKNTALNGA
  VPGPPNLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEAHI
  ALRTGGIIELTDENDFHANGTDVGFDLHHGSGGSGPGSLWSKPTPSITPTPGRKPFSSYRNDSSSSLGSASTDSY
  FGGGTSSSAAATQRLADYSPPSPALSFAHNGNNNNNGNGYTYTAGGEASVPSPDGCPELQPTFDPAPAPPPGAPL
  IWAQFERSPGGGPAAPVSSSCSSSASSSASSSSVVFPGGGASAPSNANLGLLVHRRLHPGTSCPRLSPPLHMAPG
  AGEHHLARRVRSDPGGGGLAYAAYANGLGAQLPGLQPSDTSGSSSSSSSSSSSSSSSSGLRRKGSRDCSVCFESE
  VIAALVPCGHNLFCMECANRICEKSEPECPVCHTAVTQAIRIFS

• Structural information:
  • Protein Domains: (66..12-)
    (/note="KH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (160..22-)
    (/note="KH-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117"-)
  • Interpro: IPR004087  IPR004088  IPR036612  IPR001841  IPR013083  
  • Prosite: PS50084 PS50089
  • STRING: ENSP00000329918
• Other Databases: GeneCards:  MEX3B  Malacards:  MEX3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0000932	P-body	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0046777	protein autophosphorylation	ISS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0006468	protein phosphorylation	ISS	biological process
GO:0005509	calcium ion binding	ISS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R