• Gene id: 84203

Gene Summary

• Gene Symbol: TXNDC2   Gene   UCSC   Ensembl
• Aliases: SPTRX, SPTRX1
• Gene name: thioredoxin domain containing 2
• Alternate names: thioredoxin domain-containing protein 2, sperm-specific thioredoxin 1, spermatid-specific thioredoxin-1, sptrx-1, testicular tissue protein Li 215, thioredoxin domain containing 2 (spermatozoa),
• Gene location: 18p11.22 (9885725: 9888158)     Exons: 2     NC_000018.10
• OMIM: 617790

Protein Summary

• Protein general information: Q86VQ3  
  • Name: Thioredoxin domain containing protein 2 (Spermatid specific thioredoxin 1) (Sptrx 1)
  • Length: 553  
  • Mass: 60,404
• Sequence:

  MDVDKELGMESVKAGASGKPEMRLGTQEETSEGDANESSLLVLSSNVPLLALEFLEIAQAKEKAFLPMVSHTFHM
  RTEESDASQEGDDLPKSSANTSHPKQDDSPKSSEETIQPKEGDIPKAPEETIQSKKEDLPKSSEKAIQPKESNIP
  KSSAKPIQPKLGNIPKASVKPSQPKEGDIPKAPEETIQSKKEDLPKSSEEAIQPKEGDIPKSSAKPIQPKLGNIA
  KTSVKPSQPKESDIPKSPEETIQPKEGDIPKSSAKPIQPKLGNIPKASVKPSQPKEGDISKSPEEAIQPKEGDLP
  KSLEEAIQPKEGDIPKSPEEAIQPKEGDIPKSLEEAIQPKEGDIPKSPEETIQPKKGDIPKSPEEAIQPKEGDIP
  KSPKQAIQPKEGDIPKSLEEAIPPKEIDIPKSPEETIQPKEDDSPKSLEEATPSKEGDILKPEEETMEFPEGDKV
  KVILSKEDFEASLKEAGERLVAVDFSATWCGPCRTIRPFFHALSVKHEDVVFLEVDADNCEEVVRECAIMCVPTF
  QFYKKEEKVDELCGALKEKLEAVIAELK

• Structural information:
  • Protein Domains: Thioredoxin. (429-553)
  • Interpro: IPR005746  IPR036249  IPR013766  
  • Prosite: PS51352
  • STRING: ENSP00000304908
• Other Databases: GeneCards:  TXNDC2  Malacards:  TXNDC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000103	sulfate assimilation	IBA	biological process
GO:0001520	outer dense fiber	IEA	cellular component
GO:0004791	thioredoxin-disulfide reductase activity	ISS	molecular function
GO:0004791	thioredoxin-disulfide reductase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0006457	protein folding	IBA	biological process
GO:0006662	glycerol ether metabolic process	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	NAS	biological process
GO:0015035	protein disulfide oxidoreductase activity	IBA	molecular function
GO:0016671	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	IBA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0034599	cellular response to oxidative stress	IBA	biological process
GO:0045454	cell redox homeostasis	IBA	biological process
GO:0045454	cell redox homeostasis	NAS	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0000103	sulfate assimilation	IBA	biological process
GO:0001520	outer dense fiber	IEA	cellular component
GO:0004791	thioredoxin-disulfide reductase activity	ISS	molecular function
GO:0004791	thioredoxin-disulfide reductase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0006457	protein folding	IBA	biological process
GO:0006662	glycerol ether metabolic process	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	NAS	biological process
GO:0015035	protein disulfide oxidoreductase activity	IEA	molecular function
GO:0015035	protein disulfide oxidoreductase activity	IBA	molecular function
GO:0016671	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	IBA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0034599	cellular response to oxidative stress	IBA	biological process
GO:0045454	cell redox homeostasis	IEA	biological process
GO:0045454	cell redox homeostasis	IBA	biological process
GO:0045454	cell redox homeostasis	NAS	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0000103	sulfate assimilation	IBA	biological process
GO:0004791	thioredoxin-disulfide reductase activity	ISS	molecular function
GO:0004791	thioredoxin-disulfide reductase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0006457	protein folding	IBA	biological process
GO:0007283	spermatogenesis	NAS	biological process
GO:0015035	protein disulfide oxidoreductase activity	IBA	molecular function
GO:0016671	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor	IBA	molecular function
GO:0034599	cellular response to oxidative stress	IBA	biological process
GO:0045454	cell redox homeostasis	IBA	biological process
GO:0045454	cell redox homeostasis	NAS	biological process

Diseases

Associated diseases	References
Cardiovascular disease	GAD: 17903301
Protects these cells against the increases in oxidative stress associated with paternal age	MIK: 23707457
Azoospermia	MIK: 24728569
Azoospermia	MIK: 24728569
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24728569	Azoospermia			114 (83 semen samples, 31 non-obstructive azoospermia)	Male infertility	TSPY1 DAZ SPTRX3 and SPTRX1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)