• Gene id: 84189

Gene Summary

• Gene Symbol: SLITRK6   Gene   UCSC   Ensembl
• Aliases: DFNMYP
• Gene name: SLIT and NTRK like family member 6
• Alternate names: SLIT and NTRK-like protein 6, 4832410J21Rik, slit and trk like gene 6,
• Gene location: 13q31.1 (85799418: 85792789)     Exons: 12     NC_000013.11
• Gene summary(Entrez): This gene encodes a member of the SLITRK protein family. Members of this family are integral membrane proteins that are characterized by two N-terminal leucine-rich repeat (LRR) domains and a C-terminal region that shares homology with trk neurotrophin re
• OMIM: 609681

Protein Summary

• Protein general information: Q9H5Y7  
  • Name: SLIT and NTRK like protein 6
  • Length: 841  
  • Mass: 95110
  • Tissue specificity: In adult brain, highly expressed in putamen with no expression in cerebral cortex. Expressed in adult and fetal lung and fetal liver. Also expressed at high levels in some brain tumors including medulloblastomas and primitive neuroecto
• Sequence:

  MKLWIHLFYSSLLACISLHSQTPVLSSRGSCDSLCNCEEKDGTMLINCEAKGIKMVSEISVPPSRPFQLSLLNNG
  LTMLHTNDFSGLTNAISIHLGFNNIADIEIGAFNGLGLLKQLHINHNSLEILKEDTFHGLENLEFLQADNNFITV
  IEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQLQTLPYVGFLEHIGRILDLQLEDNKWACNCD
  LLQLKTWLENMPPQSIIGDVVCNSPPFFKGSILSRLKKESICPTPPVYEEHEDPSGSLHLAATSSINDSRMSTKT
  TSILKLPTKAPGLIPYITKPSTQLPGPYCPIPCNCKVLSPSGLLIHCQERNIESLSDLRPPPQNPRKLILAGNII
  HSLMKSDLVEYFTLEMLHLGNNRIEVLEEGSFMNLTRLQKLYLNGNHLTKLSKGMFLGLHNLEYLYLEYNAIKEI
  LPGTFNPMPKLKVLYLNNNLLQVLPPHIFSGVPLTKVNLKTNQFTHLPVSNILDDLDLLTQIDLEDNPWDCSCDL
  VGLQQWIQKLSKNTVTDDILCTSPGHLDKKELKALNSEILCPGLVNNPSMPTQTSYLMVTTPATTTNTADTILRS
  LTDAVPLSVLILGLLIMFITIVFCAAGIVVLVLHRRRRYKKKQVDEQMRDNSPVHLQYSMYGHKTTHHTTERPSA
  SLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQ
  DASSLYRNILEKERELQQLGITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQTKNEYFELKA
  NLHAEPDYLEVLEQQT

• Structural information:
  • Protein Domains: (27..6-)
    (/note="LRRNT-1)
    (218..26-)
    (/note="LRRCT-1)
    (320..36-)
    (/note="LRRNT-2)
    (517..56-)
    (/note="LRRCT-2")
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • STRING: ENSP00000383143
• Other Databases: GeneCards:  SLITRK6  Malacards:  SLITRK6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007409	axonogenesis	IBA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007601	visual perception	IEA	biological process
GO:0007605	sensory perception of sound	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0007416	synapse assembly	IMP	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0071944	cell periphery	IEA	cellular component
GO:0043010	camera-type eye development	IEA	biological process
GO:0042472	inner ear morphogenesis	IEA	biological process
GO:0031223	auditory behavior	IEA	biological process
GO:0008344	adult locomotory behavior	IEA	biological process
GO:0007601	visual perception	IEA	biological process
GO:0002088	lens development in camera-type eye	IEA	biological process
GO:0001964	startle response	IEA	biological process
GO:0090102	cochlea development	IEA	biological process
GO:0060384	innervation	IEA	biological process
GO:0060007	linear vestibuloocular reflex	IEA	biological process
GO:0060005	vestibular reflex	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0048812	neuron projection morphogenesis	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0021562	vestibulocochlear nerve development	IEA	biological process
GO:0007416	synapse assembly	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0002093	auditory receptor cell morphogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

Diseases

Associated diseases	References
Deafness and myopia	KEGG:H02355
Deafness and myopia	KEGG:H02355
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)