Male Infertility Database

Search Result

Gene id

84179

Gene Summary Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

SLC49A3 Gene UCSC Ensembl

Aliases

LP2561, MFSD7

Gene name

solute carrier family 49 member 3

Alternate names

solute carrier family 49 member A3, MYL5, major facilitator superfamily domain containing 7, major facilitator superfamily domain-containing protein 7, myosin light polypeptide 5 regulatory protein,

Gene location

4p16.3 (690747: 676204) Exons: 13 NC_000004.12

Protein Summary

Protein general information

Q6UXD7

Name: Solute carrier family 49 member A3 (Major facilitator superfamily domain containing protein 7) (Myosin light polypeptide 5 regulatory protein) (MYL5)

Length: 560 Mass: 58427

Sequence

MAGPTEAETGLAEPRALCAQRGHRTYARRWVFLLAISLLNCSNATLWLSFAPVADVIAEDLVLSMEQINWLSLVY
LVVSTPFGVAAIWILDSVGLRAATILGAWLNFAGSVLRMVPCMVVGTQNPFAFLMGGQSLCALAQSLVIFSPAKL
AALWFPEHQRATANMLATMSNPLGVLVANVLSPVLVKKGEDIPLMLGVYTIPAGVVCLLSTICLWESVPPTPPSA
GAASSTSEKFLDGLKLQLMWNKAYVILAVCLGGMIGISASFSALLEQILCASGHSSGFSGLCGALFITFGILGAL
ALGPYVDRTKHFTEATKIGLCLFSLACVPFALVSQLQGQTLALAATCSLLGLFGFSVGPVAMELAVECSFPVGEG
AATGMIFVLGQAEGILIMLAMTALTVRRSEPSLSTCQQGEDPLDWTVSLLLMAGLCTFFSCILAVFFHTPYRRLQ
AESGEPPSTRNAVGGADSGPGVDRGGAGRAGVLGPSTATPECTARGASLEDPRGPGSPHPACHRATPRAQGPAAT
DAPSRPGRLAGRVQASRFIDPAGSHSSFSSPWVIT

Structural information

Interpro:	IPR011701 IPR036259
STRING:	ENSP00000384616

Other Databases

GeneCards: SLC49A3 Malacards: SLC49A3

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of mem brane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Expand All | Collapse All

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract
31037746	Spermatoge nic defect s	16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R	Show abstract
25753583	Unexplaine d infertil ity	46 (17 fertile men, 29 male pa tients)	Male infertility	Microarray	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All