• Gene id: 84174

Gene Summary

• Gene Symbol: SLA2   Gene   UCSC   Ensembl
• Aliases: C20orf156, MARS, SLAP-2, SLAP2
• Gene name: Src like adaptor 2
• Alternate names: src-like-adapter 2, Src-like adapter protein-2, modulator of antigen receptor signaling,
• Gene location: 20q11.23 (36646206: 36612317)     Exons: 2     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the SLAP family of adapter proteins. The encoded protein may play an important receptor-proximal role in downregulating T and B cell-mediated responses and inhibits antigen receptor-induced calcium mobilization. This protein
• OMIM: 606577

Protein Summary

• Protein general information: Q9H6Q3  
  • Name: Src like adapter 2 (Modulator of antigen receptor signaling) (MARS) (Src like adapter protein 2) (SLAP 2)
  • Length: 261  
  • Mass: 28585
  • Tissue specificity: Predominantly expressed in immune system, with highest levels in peripheral blood leukocytes. Expressed in spleen, thymus and lymph nodes. Expressed in T-cells as well as in monocytes, and at low level in B-cells. Also detected in plac
• Sequence:

  MGSLPSRRKSLPSPSLSSSVQGQGPVTMEAERSKATAVALGSFPAGGPAELSLRLGEPLTIVSEDGDWWTVLSEV
  SGREYNIPSVHVAKVSHGWLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWDRIRHYRI
  HCLDNGWLYISPRLTFPSLQALVDHYSELADDICCLLKEPCVLQRAGPLPGKDIPLPVTVQRTPLNWKELDSSLL
  FSEAATGEESLLSEGLRESLSFYISLNDEAVSLDDA

• Structural information:
  • Protein Domains: (32..9-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (94..19-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191"-)
  • Interpro: IPR000980  IPR036860  IPR036028  IPR001452  IPR035054   IPR035052  
  • Prosite: PS50001 PS50002
  • CDD: cd10344
  • PDB: 4M4Z
  • PDBsum: 4M4Z
  • STRING: ENSP00000262866
• Other Databases: GeneCards:  SLA2  Malacards:  SLA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IBA	molecular function
GO:0005942	phosphatidylinositol 3-kinase complex	IBA	cellular component
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0009966	regulation of signal transduction	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042110	T cell activation	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0042110	T cell activation	IDA	biological process
GO:0050849	negative regulation of calcium-mediated signaling	IDA	biological process
GO:0035591	signaling adaptor activity	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0050860	negative regulation of T cell receptor signaling pathway	IMP	biological process
GO:0010008	endosome membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0050776	regulation of immune response	NAS	biological process
GO:0019724	B cell mediated immunity	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0050851	antigen receptor-mediated signaling pathway	TAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq