• Gene id: 8417

Gene Summary

• Gene Symbol: STX7   Gene   UCSC   Ensembl
• Gene name: syntaxin 7
• Alternate names: syntaxin-7,
• Gene location: 6q23.2 (132513471: 132445866)     Exons: 13     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a syntaxin family membrane receptor involved in vesicle transport. The encoded protein binds alpha-SNAP, an important regulator of transport vesicle fusion. Along with syntaxin 13, this protein plays a role in the order
• OMIM: 603217

Protein Summary

• Protein general information: O15400  
  • Name: Syntaxin 7
  • Length: 261  
  • Mass: 29816
  • Tissue specificity: Highest expression is found in placenta followed by heart, skeletal muscle, kidney and brain. Low expression is found in pancreas, lung and liver.
• Sequence:

  MSYTPGVGGDPAQLAQRISSNIQKITQCSVEIQRTLNQLGTPQDSPELRQQLQQKQQYTNQLAKETDKYIKEFGS
  LPTTPSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVSGSFPEDSSKERNLVSWESQTQ
  PQVQVQDEEITEDDLRLIHERESSIRQLEADIMDINEIFKDLGMMIHEQGDVIDSIEANVENAEVHVQQANQQLS
  RAADYQRKSRKTLCIIILILVIGVAIISLIIWGLNH

• Structural information:
  • Protein Domains: (165..22-)
    homology (/note="t-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00202"-)
  • Interpro: IPR010989  IPR006012  IPR006011  IPR000727  
  • Prosite: PS00914 PS50192
  • CDD: cd00179
  • DIP: 57384
  • STRING: ENSP00000356918
• Other Databases: GeneCards:  STX7  Malacards:  STX7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000149	SNARE binding	IBA	molecular function
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0006886	intracellular protein transport	IBA	biological process
GO:0016021	integral component of membrane	IBA	cellular component
GO:0006906	vesicle fusion	IBA	biological process
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0031201	SNARE complex	IBA	cellular component
GO:0048278	vesicle docking	IBA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005484	SNAP receptor activity	IEA	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0000149	SNARE binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031901	early endosome membrane	IEA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0070820	tertiary granule	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0070925	organelle assembly	IDA	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0042582	azurophil granule	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0001772	immunological synapse	IDA	cellular component
GO:0051640	organelle localization	IDA	biological process
GO:0031982	vesicle	IDA	cellular component
GO:1903076	regulation of protein localization to plasma membrane	IDA	biological process
GO:0019869	chloride channel inhibitor activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0030139	endocytic vesicle	IDA	cellular component
GO:1902685	positive regulation of receptor localization to synapse	IMP	biological process
GO:0001916	positive regulation of T cell mediated cytotoxicity	IMP	biological process
GO:0019905	syntaxin binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray