• Gene id: 84159

Gene Summary

• Gene Symbol: ARID5B   Gene   UCSC   Ensembl
• Aliases: DESRT, MRF-2, MRF2
• Gene name: AT-rich interaction domain 5B
• Alternate names: AT-rich interactive domain-containing protein 5B, ARID domain-containing protein 5B, AT-rich interactive domain 5B (MRF1-like), MRF1-like protein, modulator recognition factor 2 (MRF2),
• Gene location: 10q21.2 (61901253: 62096943)     Exons: 12     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the AT-rich interaction domain (ARID) family of DNA binding proteins. The encoded protein forms a histone H3K9Me2 demethylase complex with PHD finger protein 2 and regulates the transcription of target genes involved in adipo
• OMIM: 608538

Protein Summary

• Protein general information: Q14865  
  • Name: AT rich interactive domain containing protein 5B (ARID domain containing protein 5B) (MRF1 like protein) (Modulator recognition factor 2) (MRF 2)
  • Length: 1188  
  • Mass: 132375
  • Tissue specificity: Widely expressed, including in liver (at protein level). {ECO
• Sequence:

  MEPNSLQWVGSPCGLHGPYIFYKAFQFHLEGKPRILSLGDFFFVRCTPKDPICIAELQLLWEERTSRQLLSSSKL
  YFLPEDTPQGRNSDHGEDEVIAVSEKVIVKLEDLVKWVHSDFSKWRCGFHAGPVKTEALGRNGQKEALLKYRQST
  LNSGLNFKDVLKEKADLGEDEEETNVIVLSYPQYCRYRSMLKRIQDKPSSILTDQFALALGGIAVVSRNPQILYC
  RDTFDHPTLIENESICDEFAPNLKGRPRKKKPCPQRRDSFSGVKDSNNNSDGKAVAKVKCEARSALTKPKNNHNC
  KKVSNEEKPKVAIGEECRADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETITARRQWK
  HIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPIKPRKQENSSQENENKTKVSGTKRIKHEIPK
  SKKEKENAPKPQDAAEVSSEQEKEQETLISQKSIPEPLPAADMKKKIEGYQEFSAKPLASRVDPEKDNETDQGSN
  SEKVAEEAGEKGPTPPLPSAPLAPEKDSALVPGASKQPLTSPSALVDSKQESKLCCFTESPESEPQEASFPSFPT
  TQPPLANQNETEDDKLPAMADYIANCTVKVDQLGSDDIHNALKQTPKVLVVQSFDMFKDKDLTGPMNENHGLNYT
  PLLYSRGNPGIMSPLAKKKLLSQVSGASLSSSYPYGSPPPLISKKKLIARDDLCSSLSQTHHGQSTDHMAVSRPS
  VIQHVQSFRSKPSEERKTINDIFKHEKLSRSDPHRCSFSKHHLNPLADSYVLKQEIQEGKDKLLEKRALPHSHMP
  SFLADFYSSPHLHSLYRHTEHHLHNEQTSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQDKKSAAAEAP
  TDDQPTDLSLPKNPHKPTGKVLGLAHSTTGPQESKGISQFQVLGSQSRDCHPKACRVSPMTMSGPKKYPESLSRS
  GKPHHVRLENFRKMEGMVHPILHRKMSPQNIGAARPIKRSLEDLDLVIAGKKARAVSPLDPSKEVSGKEKASEQE
  SEGSKAAHGGHSGGGSEGHKLPLSSPIFPGLYSGSLCNSGLNSRLPAGYSHSLQYLKNQTVLSPLMQPLAFHSLV
  MQRGIFTSPTNSQQLYRHLAAATPVGSSYGDLLHNSIYPLAAINPQAAFPSSQLSSVHPSTKL

• Structural information:
  • Protein Domains: (318..41-)
    (/note="ARID-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00355"-)
  • Interpro: IPR030408  IPR001606  IPR036431  
  • Prosite: PS51011
  • PDB: 1IG6 2OEH
  • PDBsum: 1IG6 2OEH
  • STRING: ENSP00000279873
• Other Databases: GeneCards:  ARID5B  Malacards:  ARID5B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0051091	positive regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0060612	adipose tissue development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0001889	liver development	TAS	biological process
GO:0060612	adipose tissue development	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0051091	positive regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060613	fat pad development	IEA	biological process
GO:0060612	adipose tissue development	IEA	biological process
GO:0060325	face morphogenesis	IEA	biological process
GO:0048705	skeletal system morphogenesis	IEA	biological process
GO:0048644	muscle organ morphogenesis	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0030325	adrenal gland development	IEA	biological process
GO:0010761	fibroblast migration	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0008585	female gonad development	IEA	biological process
GO:0006807	nitrogen compound metabolic process	IEA	biological process
GO:0001822	kidney development	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0060021	roof of mouth development	IEA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0048468	cell development	IEA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0008584	male gonad development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray