• Gene id: 84152

Gene Summary

• Gene Symbol: PPP1R1B   Gene   UCSC   Ensembl
• Aliases: DARPP-32, DARPP32
• Gene name: protein phosphatase 1 regulatory inhibitor subunit 1B
• Alternate names: protein phosphatase 1 regulatory subunit 1B, dopamine and cAMP-regulated neuronal phosphoprotein 32,
• Gene location: 17q12 (39626734: 39636624)     Exons: 9     NC_000017.11
• Gene summary(Entrez): This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeu
• OMIM: 604399

Protein Summary

• Protein general information: Q9UD71  
  • Name: Protein phosphatase 1 regulatory subunit 1B (DARPP 32) (Dopamine and cAMP regulated neuronal phosphoprotein)
  • Length: 204  
  • Mass: 22963
• Sequence:

  MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYT
  PPSLKAVQRIAESHLQSISNLNENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAG
  QKTTCGQGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT

• Structural information:
  • Interpro: IPR015670  IPR008466  
  • STRING: ENSP00000254079
• Other Databases: GeneCards:  PPP1R1B  Malacards:  PPP1R1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004864	protein phosphatase inhibitor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0019888	protein phosphatase regulator activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0031750	D3 dopamine receptor binding	IEA	molecular function
GO:0031749	D2 dopamine receptor binding	IEA	molecular function
GO:0007626	locomotory behavior	IEA	biological process
GO:0007613	memory	IEA	biological process
GO:0048148	behavioral response to cocaine	IEA	biological process
GO:0043278	response to morphine	IEA	biological process
GO:0007626	locomotory behavior	IEA	biological process
GO:0007621	negative regulation of female receptivity	IEA	biological process
GO:0001975	response to amphetamine	IEA	biological process
GO:0044327	dendritic spine head	IEA	cellular component
GO:0044326	dendritic spine neck	IEA	cellular component
GO:0042220	response to cocaine	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0035094	response to nicotine	IEA	biological process
GO:0031752	D5 dopamine receptor binding	IEA	molecular function
GO:0031751	D4 dopamine receptor binding	IEA	molecular function
GO:0031748	D1 dopamine receptor binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0008542	visual learning	IEA	biological process
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0004864	protein phosphatase inhibitor activity	IDA	molecular function
GO:0032515	negative regulation of phosphoprotein phosphatase activity	IDA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0004864	protein phosphatase inhibitor activity	TAS	molecular function
GO:0004860	protein kinase inhibitor activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04024	cAMP signaling pathway
hsa05034	Alcoholism
hsa04728	Dopaminergic synapse
hsa05031	Amphetamine addiction
hsa05030	Cocaine addiction

Diseases

Associated diseases	References
Bipolar disorder	PMID:23295814
Schizophrenia	PMID:23295814
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq