• Gene id: 84133

Gene Summary

• Gene Symbol: ZNRF3   Gene   UCSC   Ensembl
• Aliases: BK747E2.3, RNF203
• Gene name: zinc and ring finger 3
• Alternate names: E3 ubiquitin-protein ligase ZNRF3, CTA-292E10.6, RING finger protein 203, RING-type E3 ubiquitin transferase ZNRF3, novel C3HC4 type Zinc finger (ring finger), zinc/RING finger protein 3,
• Gene location: 22q12.1 (28800656: 29057487)     Exons: 16     NC_000022.11
• OMIM: 614216

Protein Summary

• Protein general information: Q9ULT6  
  • Name: E3 ubiquitin protein ligase ZNRF3 (EC 2.3.2.27) (RING finger protein 203) (RING type E3 ubiquitin transferase ZNRF3) (Zinc/RING finger protein 3)
  • Length: 936  
  • Mass: 100574
• Sequence:

  MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYT
  TYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRG
  ATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDMGIFLAF
  FVVVSLVCLILLVKIKLKQRRSQNSMNRLAVQALEKMETRKFNSKSKGRREGSCGALDTLSSSSTSDCAICLEKY
  IDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNIIEQKGNPSAVCVETSNLSRGRQQRVTLPVHYPGRVHRT
  NAIPAYPTRTSMDSHGNPVTLLTMDRHGEQSLYSPQTPAYIRSYPPLHLDHSLAAHRCGLEHRAYSPAHPFRRPK
  LSGRSFSKAACFSQYETMYQHYYFQGLSYPEQEGQSPPSLAPRGPARAFPPSGSGSLLFPTVVHVAPPSHLESGS
  TSSFSCYHGHRSVCSGYLADCPGSDSSSSSSSGQCHCSSSDSVVDCTEVSNQGVYGSCSTFRSSLSSDYDPFIYR
  SRSPCRASEAGGSGSSGRGPALCFEGSPPPEELPAVHSHGAGRGEPWPGPASPSGDQVSTCSLEMNYSSNSSLEH
  RGPNSSTSEVGLEASPGAAPDLRRTWKGGHELPSCACCCEPQPSPAGPSAGAAGSSTLFLGPHLYEGSGPAGGEP
  QSGSSQGLYGLHPDHLPRTDGVKYEGLPCCFYEEKQVARGGGGGSGCYTEDYSVSVQYTLTEEPPPGCYPGARDL
  SQRIPIIPEDVDCDLGLPSDCQGTHSLGSWGGTRGPDTPRPHRGLGATREEERALCCQARALLRPGCPPEEAGAV
  RANFPSALQDTQESSTTATEAAGPRSHSADSSSPGA

• Structural information:
  • Interpro: IPR001841  IPR013083  IPR040700  
  • Prosite: PS50089
  • DIP: 50030
  • STRING: ENSP00000443824
• Other Databases: GeneCards:  ZNRF3  Malacards:  ZNRF3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	TAS	molecular function
GO:0038018	Wnt receptor catabolic process	TAS	biological process
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0038018	Wnt receptor catabolic process	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005109	frizzled binding	IBA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0016567	protein ubiquitination	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:2000051	negative regulation of non-canonical Wnt signaling pathway	IMP	biological process
GO:0072089	stem cell proliferation	ISS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0038018	Wnt receptor catabolic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005109	frizzled binding	IPI	molecular function
GO:0005109	frizzled binding	IPI	molecular function
GO:0005109	frizzled binding	IPI	molecular function
GO:0005109	frizzled binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060173	limb development	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0072089	stem cell proliferation	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	IEA	biological process
GO:2000095	regulation of Wnt signaling pathway, planar cell polarity pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq