• Gene id: 84129

Gene Summary

• Gene Symbol: ACAD11   Gene   UCSC   Ensembl
• Aliases: ACAD-11
• Gene name: acyl-CoA dehydrogenase family member 11
• Alternate names: acyl-CoA dehydrogenase family member 11, acyl-Coenzyme A dehydrogenase family, member 11,
• Gene location: 3q22.1 (132660130: 132558137)     Exons: 20     NC_000003.12
• Gene summary(Entrez): This gene encodes an acyl-CoA dehydrogenase enzyme with a preference for carbon chain lengths between 20 and 26. Naturally occurring read-through transcription occurs between the upstream gene NPHP3 (nephronophthisis 3 (adolescent)) and this gene. [provid
• OMIM: 614288

Protein Summary

• Protein general information: Q709F0  
  • Name: Acyl CoA dehydrogenase family member 11 (ACAD 11) (EC 1.3.8. )
  • Length: 780  
  • Mass: 87264
  • Tissue specificity: Widely expressed with highest levels in brain followed by liver, heart and kidney. {ECO
• Sequence:

  MKPGATGESDLAEVLPQHKFDSKSLEAYLNQHLSGFGAEREATLTIAQYRAGKSNPTFYLQKGFQTYVLRKKPPG
  SLLPKAHQIDREFKVQKALFSIGFPVPKPILYCSDTSVIGTEFYVMEHVQGRIFRDLTIPGLSPAERSAIYVATV
  ETLAQLHSLNIQSLQLEGYGIGAGYCKRQVSTWTKQYQAAAHQDIPAMQQLSEWLMKNLPDNDNEENLIHGDFRL
  DNIVFHPKECRVIAVLDWELSTIGHPLSDLAHFSLFYFWPRTVPMINQGSYSENSGIPSMEELISIYCRCRGINS
  ILPNWNFFLALSYFKMAGIAQGVYSRYLLGNNSSEDSFLFANIVQPLAETGLQLSKRTFSTVLPQIDTTGQLFVQ
  TRKGQEVLIKVKHFMKQHILPAEKEVTEFYVQNENSVDKWGKPLVIDKLKEMAKVEGLWNLFLPAVSGLSHVDYA
  LIAEETGKCFFAPDVFNCQAPDTGNMEVLHLYGSEEQKKQWLEPLLQGNITSCFCMTEPDVASSDATNIECSIQR
  DEDSYVINGKKWWSSGAGNPKCKIAIVLGRTQNTSLSRHKQHSMILVPMNTPGVKIIRPLSVFGYTDNFHGGHFE
  IHFNQVRVPATNLILGEGRGFEISQGRLGPGRIHHCMRTVGLAERALQIMCERATQRIAFKKKLYAHEVVAHWIA
  ESRIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVL
  RLADGPDEVHLSAIATMELRDQAKRLTAKI

• Structural information:
  • Interpro: IPR041726  IPR006091  IPR036250  IPR009075  IPR013786   IPR037069  IPR009100  IPR002575  IPR011009  
  • CDD: cd05154
  • PDB: 2WBI
  • PDBsum: 2WBI
  • STRING: ENSP00000264990
• Other Databases: GeneCards:  ACAD11  Malacards:  ACAD11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050660	flavin adenine dinucleotide binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016627	oxidoreductase activity, acting on the CH-CH group of donors	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	ISS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0003995	acyl-CoA dehydrogenase activity	TAS	molecular function
GO:0006635	fatty acid beta-oxidation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0006635	fatty acid beta-oxidation	IEA	biological process
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0070991	medium-chain-acyl-CoA dehydrogenase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0033539	fatty acid beta-oxidation using acyl-CoA dehydrogenase	IDA	biological process
GO:0017099	very-long-chain-acyl-CoA dehydrogenase activity	IDA	molecular function
GO:0004466	long-chain-acyl-CoA dehydrogenase activity	IDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)