About Us

Search Result


Gene id 84124
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol ZNF394   Gene   UCSC   Ensembl
Aliases ZKSCAN14, ZSCAN46
Gene name zinc finger protein 394
Alternate names zinc finger protein 394, zinc finger protein 99, zinc finger protein with KRAB and SCAN domains 14,
Gene location 7q22.1 (99500307: 99486518)     Exons: 4     NC_000007.14
Gene summary(Entrez) The protein encoded by this gene is a zinc finger protein that inhibits the transcription of mitogen-activated protein kinase signaling pathways. The encoded protein may be involved in cardiac function. [provided by RefSeq, Sep 2016]
OMIM 605058

Protein Summary

Protein general information Q53GI3  

Name: Zinc finger protein 394 (Zinc finger protein with KRAB and SCAN domains 14)

Length: 561  Mass: 64256

Sequence MNSSLTAQRRGSDAELGPWVMAARSKDAAPSQRDGLLPVKVEEDSPGSWEPNYPAASPDPETSRLHFRQLRYQEV
AGPEEALSRLRELCRRWLRPELLSKEQILELLVLEQFLTILPEELQAWVREHCPESGEEAVAVVRALQRALDGTS
SQGMVTFEDTAVSLTWEEWERLDPARRDFCRESAQKDSGSTVPPSLESRVENKELIPMQQILEEAEPQGQLQEAF
QGKRPLFSKCGSTHEDRVEKQSGDPLPLKLENSPEAEGLNSISDVNKNGSIEGEDSKNNELQNSARCSNLVLCQH
IPKAERPTDSEEHGNKCKQSFHMVTWHVLKPHKSDSGDSFHHSSLFETQRQLHEERPYKCGNCGKSFKQRSDLFR
HQRIHTGEKPYGCQECGKSFSQSAALTKHQRTHTGEKPYTCLKCGERFRQNSHLNRHQSTHSRDKHFKCEECGET
CHISNLFRHQRLHKGERPYKCEECEKSFKQRSDLFKHHRIHTGEKPYGCSVCGKRFNQSATLIKHQRIHTGEKPY
KCLECGERFRQSTHLIRHQRIHQNKVLSAGRGGSRL
Structural information
Protein Domains
(64..14-)
(/note="SCAN-box)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00187-)
(155..23-)
(/note="KRAB-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
Interpro:  IPR001909  IPR036051  IPR003309  IPR038269  IPR036236  
IPR013087  
Prosite:   PS50805 PS50804 PS00028 PS50157
CDD:   cd07765 cd07936
STRING:   ENSP00000337363
Other Databases GeneCards:  ZNF394  Malacards:  ZNF394

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0003700 DNA-binding transcription
factor activity
IEA molecular function
GO:0003676 nucleic acid binding
IEA molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component
GO:0003700 DNA-binding transcription
factor activity
IEA molecular function
GO:0003676 nucleic acid binding
IEA molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0046872 metal ion binding
IEA molecular function
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005634 nucleus
IEA cellular component
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract