• Gene id: 8411

Gene Summary

• Gene Symbol: EEA1   Gene   UCSC   Ensembl
• Aliases: MST105, MSTP105, ZFYVE2
• Gene name: early endosome antigen 1
• Alternate names: early endosome antigen 1, early endosome antigen 1, 162kD, early endosome-associated protein, endosome-associated protein p162, zinc finger FYVE domain-containing protein 2,
• Gene location: 12q22 (92975227: 92770636)     Exons: 32     NC_000012.12
• OMIM: 0

Protein Summary

• Protein general information: Q15075  
  • Name: Early endosome antigen 1 (Endosome associated protein p162) (Zinc finger FYVE domain containing protein 2)
  • Length: 1411  
  • Mass: 162466
• Sequence:

  MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGE
  SNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQQQEAKPDGLVTDSSAELQSLEQQLEEAQTE
  NFNIKQMKDLFEQKAAQLATEIADIKSKYDEERSLREAAEQKVTRLTEELNKEATVIQDLKTELLQRPGIEDVAV
  LKKELVQVQTLMDNMTLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGPQEVAVYVQELQKLKSSVNEL
  TQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSASETSLHRIHVELSEKGEATQ
  KLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLHSKLLETERQLGEAHGRLKEQRQLSSEKLMD
  KEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKI
  QNLEALLQKSKENISLLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHD
  QVQEQKAHLRAAQDRVLSLETSVNELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNA
  LQDKQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKYLSLEQKTEELEGQIKKLEADSLEVKASKEQAL
  QDLQQQRQLNTDLELRATELSKQLEMEKEIVSSTRLDLQKKSEALESIKQKLTKQEEEKKILKQDFETLSQETKI
  QHEELNNRIQTTVTELQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQ
  LQVQMENTLKEQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQNEKEEQQLQGNINELKQSSEQKKKQI
  EALQGELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNNYEKSQETFKQLQSDFYGRESELLATRQDLK
  SVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELVNEKSK
  LAEIEEIKCRQEKEITKLNEELKSHKLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQV
  KKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLR
  GEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWA
  EDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG

• Structural information:
  • Interpro: IPR013087  IPR000306  IPR017455  IPR011011  IPR013083  
  • Prosite: PS50178 PS00028 PS50157
  • PDB: 1HYI 1HYJ 1JOC 3MJH
  • PDBsum: 1HYI 1HYJ 1JOC 3MJH
  • STRING: ENSP00000317955
• Other Databases: GeneCards:  EEA1  Malacards:  EEA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0039694	viral RNA genome replication	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005545	1-phosphatidylinositol binding	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0005769	early endosome	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0055037	recycling endosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0044308	axonal spine	IEA	cellular component
GO:0005969	serine-pyruvate aminotransferase complex	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0030742	GTP-dependent protein binding	IDA	molecular function
GO:0019897	extrinsic component of plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005545	1-phosphatidylinositol binding	IDA	molecular function
GO:0005769	early endosome	IDA	cellular component
GO:0008270	zinc ion binding	TAS	molecular function
GO:0006906	vesicle fusion	IMP	biological process
GO:0006897	endocytosis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016189	synaptic vesicle to endosome fusion	TAS	biological process
GO:0005516	calmodulin binding	NAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045022	early endosome to late endosome transport	NAS	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05152	Tuberculosis
hsa04145	Phagosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881