• Gene id: 84109

Gene Summary

• Gene Symbol: QRFPR   Gene   UCSC   Ensembl
• Aliases: AQ27, GPR103, SP9155
• Gene name: pyroglutamylated RFamide peptide receptor
• Alternate names: pyroglutamylated RF-amide peptide receptor, G-protein coupled receptor 103, QRFP receptor, orexigenic neuropeptide QRFP receptor, peptide P518 receptor,
• Gene location: 4q27 (121381053: 121328641)     Exons: 7     NC_000004.12
• OMIM: 606925

Protein Summary

• Protein general information: Q96P65  
  • Name: Pyroglutamylated RF amide peptide receptor (AQ27) (G protein coupled receptor 103) (Orexigenic neuropeptide QRFP receptor) (SP9155)
  • Length: 431  
  • Mass: 49488
  • Tissue specificity: Expressed widely in the brain with high levels in the hypothalamus, trigeminal ganglia and vestibular neurons, and moderate levels in the amygdala, cortex, pituitary, hippocampus, thalamus, caudate nucleus and medulla oblongata. In per
• Sequence:

  MQALNITPEQFSRLLRDHNLTREQFIALYRLRPLVYTPELPGRAKLALVLTGVLIFALALFGNALVFYVVTRSKA
  MRTVTNIFICSLALSDLLITFFCIPVTMLQNISDNWLGGAFICKMVPFVQSTAVVTEILTMTCIAVERHQGLVHP
  FKMKWQYTNRRAFTMLGVVWLVAVIVGSPMWHVQQLEIKYDFLYEKEHICCLEEWTSPVHQKIYTTFILVILFLL
  PLMVMLILYSKIGYELWIKKRVGDGSVLRTIHGKEMSKIARKKKRAVIMMVTVVALFAVCWAPFHVVHMMIEYSN
  FEKEYDDVTIKMIFAIVQIIGFSNSICNPIVYAFMNENFKKNVLSAVCYCIVNKTFSPAQRHGNSGITMMRKKAK
  FSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAENSPLDSGH

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000611  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000377948
• Other Databases: GeneCards:  QRFPR  Malacards:  QRFPR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004983	neuropeptide Y receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IC	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0004930	G protein-coupled receptor activity	IDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)