• Gene id: 84106

Gene Summary

• Gene Symbol: PRAM1   Gene   UCSC   Ensembl
• Aliases: PML-RAR, PRAM-1
• Gene name: PML-RARA regulated adaptor molecule 1
• Alternate names: PML-RARA-regulated adapter molecule 1, PML-RARA target gene encoding an Adaptor Molecule-1, PRAM,
• Gene location: 19p13.2 (8502639: 8490054)     Exons: 10     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is similar to FYN binding protein (FYB/SLAP-130), an adaptor protein involved in T cell receptor mediated signaling. This gene is expressed and regulated during normal myelopoiesis. The expression of this gene is induced b
• OMIM: 606466

Protein Summary

• Protein general information: Q96QH2  
  • Name: PML RARA regulated adapter molecule 1 (PRAM) (PRAM 1)
  • Length: 670  
  • Mass: 73969
  • Tissue specificity: Expressed in peripheral blood leukocytes and bone marrow. Expressed in monocytes, and to a lesser extent in granulocytes and lymphocytes. Not expressed in non hematopoietic tissues except in lung. {ECO
• Sequence:

  MAHHLPAAMESHQDFRSIKAKFQASQPEPSDLPKKPPKPEFGKLKKFSQPELSEHPKKAPLPEFGAVSLKPPPPE
  VTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPSKLELSDLSKKFPQLGATPFPRKPLQPEVGE
  APLKASLPEPGAPARKPLQPDELSHPARPPSEPKSGAFPRKLWQPEAGEATPRSPQPELSTFPKKPAQPEFNVYP
  KKPPQPQVGGLPKKSVPQPEFSEAAQTPLWKPQSSEPKRDSSAFPKKASQPPLSDFPKKPPQPELGDLTRTSSEP
  EVSVLPKRPRPAEFKALSKKPPQPELGGLPRTSSEPEFNSLPRKLLQPERRGPPRKFSQPEPSAVLKRHPQPEFF
  GDLPRKPPLPSSASESSLPAAVAGFSSRHPLSPGFGAAGTPRWRSGGLVHSGGARPGLRPSHPPRRRPLPPASSL
  GHPPAKPPLPPGPVDMQSFRRPSAASIDLRRTRSAAGLHFQDRQPEDIPQVPDEIYELYDDVEPRDDSSPSPKGR
  DEAPSVQQAARRPPQDPALRKEKDPQPQQLPPMDPKLLKQLRKAEKAEREFRKKFKFEGEIVVHTKMMIDPNAKT
  RRGGGKHLGIRRGEILEVIEFTSNEEMLCRDPKGKYGYVPRTALLPLETEVYDDVDFCDPLENQPLPLGR

• Structural information:
  • Protein Domains: (571..64-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR029294  IPR036028  IPR001452  
  • Prosite: PS50002
  • STRING: ENSP00000408342
• Other Databases: GeneCards:  PRAM1  Malacards:  PRAM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050852	T cell receptor signaling pathway	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0072659	protein localization to plasma membrane	IBA	biological process
GO:0007229	integrin-mediated signaling pathway	IBA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043313	regulation of neutrophil degranulation	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)