• Gene id: 841

Gene Summary

• Gene Symbol: CASP8   Gene   UCSC   Ensembl
• Aliases: ALPS2B, CAP4, Casp-8, FLICE, MACH, MCH5
• Gene name: caspase 8
• Alternate names: caspase-8, FADD-homologous ICE/CED-3-like protease, FADD-like ICE, ICE-like apoptotic protease 5, MACH-alpha-1/2/3 protein, MACH-beta-1/2/3/4 protein, MORT1-associated ced-3 homolog, apoptotic cysteine protease, apoptotic protease Mch-5, caspase 8, apopto,
• Gene location: 2q33.1 (201233442: 201287710)     Exons: 14     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain, a large pro
• OMIM: 601763

SNPs

rs17005650

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000004.12   g.122318633G>C
NC_000004.11   g.123239788G>C
NG_015813.2   g.153031G>C
NG_015813.1   g.153031G>C|SEQ=[G/C]|GENE=KIAA1109

rs3834129

Strand:    Allele origin:   Allele change:   Mutation type: del

NC_000002.12   g.201232809_201232814del
NC_000002.11   g.202097532_202097537del
NG_007497.1   g.4352_4357del|SEQ=[AGTAAG/-]|GENE=CASP8

Protein Summary

• Protein general information: Q14790  
  • Name: Caspase 8 (CASP 8) (EC 3.4.22.61) (Apoptotic cysteine protease) (Apoptotic protease Mch 5) (CAP4) (FADD homologous ICE/ced 3 like protease) (FADD like ICE) (FLICE) (ICE like apoptotic protease 5) (MORT1 associated ced 3 homolog) (MACH) [Cleaved into: Casp
  • Length: 479  
  • Mass: 55,391
• Sequence:

  MDFSRNLYDIGEQLDSEDLASLKFLSLDYIPQRKQEPIKDALMLFQRLQEKRMLEESNLSFLKELLFRINRLDLL
  ITYLNTRKEEMERELQTPGRAQISAYRVMLYQISEEVSRSELRSFKFLLQEEISKCKLDDDMNLLDIFIEMEKRV
  ILGEGKLDILKRVCAQINKSLLKIINDYEEFSKERSSSLEGSPDEFSNGEELCGVMTISDSPREQDSESQTLDKV
  YQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQ
  LMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDS
  EEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEV
  SNKDDKKNMGKQMPQPTFTLRKKLVFPSD

• Structural information:
  • Protein Domains: DED (2-80)
    DED (100-177)
  • Interpro: IPR033170  IPR029030  IPR033139  IPR016129  IPR011029   IPR001875  IPR002138  IPR001309  IPR015917  
  • Prosite: PS01122 PS01121 PS50207 PS50208 PS50168
  • CDD: cd00032
  • PDB: 1F9E 1I4E 1QDU 1QTN 2C2Z 2FUN 2K7Z 2Y1L 3H11 3KJN 3KJQ 4JJ7 4PRZ 4PS1 4ZBW 5H31 5H33 5JQE 5L08
  • PDBsum: 1F9E 1I4E 1QDU 1QTN 2C2Z 2FUN 2K7Z 2Y1L 3H11 3KJN 3KJQ 4JJ7 4PRZ 4PS1 4ZBW 5H31 5H33 5JQE 5L08
  • DIP: 30915
  • STRING: ENSP00000351273
• Other Databases: GeneCards:  CASP8  Malacards:  CASP8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0005123	death receptor binding	IEA	molecular function
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005815	microtubule organizing center	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0006915	apoptotic process	IGI	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0006921	cellular component disassembly involved in execution phase of apoptosis	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0008233	peptidase activity	IMP	molecular function
GO:0008234	cysteine-type peptidase activity	TAS	molecular function
GO:0009409	response to cold	IEA	biological process
GO:0010803	regulation of tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0010939	regulation of necrotic cell death	TAS	biological process
GO:0030101	natural killer cell activation	TAS	biological process
GO:0030225	macrophage differentiation	TAS	biological process
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0031265	CD95 death-inducing signaling complex	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032025	response to cobalt ion	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0034612	response to tumor necrosis factor	IMP	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0035877	death effector domain binding	IPI	molecular function
GO:0036462	TRAIL-activated apoptotic signaling pathway	IDA	biological process
GO:0039650	suppression by virus of host cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0039650	suppression by virus of host cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0042110	T cell activation	TAS	biological process
GO:0042113	B cell activation	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043005	neuron projection	IEA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0044297	cell body	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0045471	response to ethanol	IEA	biological process
GO:0045651	positive regulation of macrophage differentiation	IMP	biological process
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0046677	response to antibiotic	IEA	biological process
GO:0051291	protein heterooligomerization	IEA	biological process
GO:0051603	proteolysis involved in cellular protein catabolic process	IMP	biological process
GO:0060715	syncytiotrophoblast cell differentiation involved in labyrinthine layer development	TAS	biological process
GO:0070423	nucleotide-binding oligomerization domain containing signaling pathway	TAS	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0071550	death-inducing signaling complex assembly	TAS	biological process
GO:0097110	scaffold protein binding	IPI	molecular function
GO:0097153	cysteine-type endopeptidase activity involved in apoptotic process	IMP	molecular function
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0097194	execution phase of apoptosis	IMP	biological process
GO:0097199	cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	molecular function
GO:0097202	activation of cysteine-type endopeptidase activity	IDA	biological process
GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	TAS	biological process
GO:0097342	ripoptosome	IDA	cellular component
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:0004197	cysteine-type endopeptidase activity	IEA	molecular function
GO:0004197	cysteine-type endopeptidase activity	IEA	molecular function
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0005123	death receptor binding	IEA	molecular function
GO:0005164	tumor necrosis factor receptor binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005815	microtubule organizing center	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IGI	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0006921	cellular component disassembly involved in execution phase of apoptosis	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008233	peptidase activity	IMP	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0008234	cysteine-type peptidase activity	TAS	molecular function
GO:0009409	response to cold	IEA	biological process
GO:0010803	regulation of tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0010939	regulation of necrotic cell death	TAS	biological process
GO:0016032	viral process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0030101	natural killer cell activation	TAS	biological process
GO:0030225	macrophage differentiation	TAS	biological process
GO:0031264	death-inducing signaling complex	IEA	cellular component
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0031265	CD95 death-inducing signaling complex	IEA	cellular component
GO:0031265	CD95 death-inducing signaling complex	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032025	response to cobalt ion	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0034612	response to tumor necrosis factor	IMP	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0035877	death effector domain binding	IPI	molecular function
GO:0036462	TRAIL-activated apoptotic signaling pathway	IDA	biological process
GO:0039650	suppression by virus of host cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0039650	suppression by virus of host cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0042110	T cell activation	TAS	biological process
GO:0042113	B cell activation	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0043005	neuron projection	IEA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043234	protein complex	IEA	cellular component
GO:0044297	cell body	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0045471	response to ethanol	IEA	biological process
GO:0045651	positive regulation of macrophage differentiation	IMP	biological process
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0046677	response to antibiotic	IEA	biological process
GO:0051291	protein heterooligomerization	IEA	biological process
GO:0051603	proteolysis involved in cellular protein catabolic process	IMP	biological process
GO:0060715	syncytiotrophoblast cell differentiation involved in labyrinthine layer development	TAS	biological process
GO:0070423	nucleotide-binding oligomerization domain containing signaling pathway	TAS	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:0071550	death-inducing signaling complex assembly	TAS	biological process
GO:0097110	scaffold protein binding	IPI	molecular function
GO:0097153	cysteine-type endopeptidase activity involved in apoptotic process	IMP	molecular function
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0097194	execution phase of apoptosis	IMP	biological process
GO:0097199	cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	molecular function
GO:0097202	activation of cysteine-type endopeptidase activity	IDA	biological process
GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	TAS	biological process
GO:0097342	ripoptosome	IDA	cellular component
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:0004197	cysteine-type endopeptidase activity	IDA	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0004197	cysteine-type endopeptidase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005815	microtubule organizing center	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	TAS	cellular component
GO:0006508	proteolysis	IDA	biological process
GO:0006915	apoptotic process	IGI	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0006921	cellular component disassembly involved in execution phase of apoptosis	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0008233	peptidase activity	IMP	molecular function
GO:0008234	cysteine-type peptidase activity	TAS	molecular function
GO:0010803	regulation of tumor necrosis factor-mediated signaling pathway	TAS	biological process
GO:0010939	regulation of necrotic cell death	TAS	biological process
GO:0030101	natural killer cell activation	TAS	biological process
GO:0030225	macrophage differentiation	TAS	biological process
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0031264	death-inducing signaling complex	IDA	cellular component
GO:0031265	CD95 death-inducing signaling complex	IDA	cellular component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0034612	response to tumor necrosis factor	IMP	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0035877	death effector domain binding	IPI	molecular function
GO:0036462	TRAIL-activated apoptotic signaling pathway	IDA	biological process
GO:0039650	suppression by virus of host cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0039650	suppression by virus of host cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0042110	T cell activation	TAS	biological process
GO:0042113	B cell activation	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0045651	positive regulation of macrophage differentiation	IMP	biological process
GO:0045862	positive regulation of proteolysis	IDA	biological process
GO:0051603	proteolysis involved in cellular protein catabolic process	IMP	biological process
GO:0060715	syncytiotrophoblast cell differentiation involved in labyrinthine layer development	TAS	biological process
GO:0070423	nucleotide-binding oligomerization domain containing signaling pathway	TAS	biological process
GO:0071260	cellular response to mechanical stimulus	IEP	biological process
GO:0071550	death-inducing signaling complex assembly	TAS	biological process
GO:0097110	scaffold protein binding	IPI	molecular function
GO:0097153	cysteine-type endopeptidase activity involved in apoptotic process	IMP	molecular function
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097190	apoptotic signaling pathway	TAS	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0097194	execution phase of apoptosis	IMP	biological process
GO:0097199	cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IMP	molecular function
GO:0097202	activation of cysteine-type endopeptidase activity	IDA	biological process
GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	TAS	biological process
GO:0097342	ripoptosome	IDA	cellular component
GO:1900740	positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:1902041	regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04668	TNF signaling pathway
hsa04210	Apoptosis
hsa04215	Apoptosis - multiple species
hsa04217	Necroptosis
hsa04115	p53 signaling pathway
hsa04620	Toll-like receptor signaling pathway
hsa04621	NOD-like receptor signaling pathway
hsa04622	RIG-I-like receptor signaling pathway
hsa04625	C-type lectin receptor signaling pathway
hsa04657	IL-17 signaling pathway
hsa05200	Pathways in cancer
hsa05203	Viral carcinogenesis
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05416	Viral myocarditis
hsa04932	Non-alcoholic fatty liver disease
hsa05130	Pathogenic Escherichia coli infection
hsa05134	Legionellosis
hsa05152	Tuberculosis
hsa05170	Human immunodeficiency virus 1 infection
hsa05162	Measles
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05168	Herpes simplex virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05169	Epstein-Barr virus infection
hsa05165	Human papillomavirus infection
hsa05145	Toxoplasmosis
hsa05142	Chagas disease
hsa01524	Platinum drug resistance

Diseases

Associated diseases	References
Cancer	GAD: 20176653
Cancer (Adenocarcinoma)	GAD: 20402676
Cancer (glioma)	GAD: 18398042
Cancer (head and neck)	GAD: 20819778
Cancer (leukemia)	GAD: 19074885
Cancer (lung)	GAD: 16938569
Cancer (lymphoma)	GAD: 17071630
Cancer (melanoma)	GAD: 18563783
Cancer (meningeal)	GAD: 18823701
Cancer (myeloma)	GAD: 18381704
Cancer (ovarian)	GAD: 20978178
Cancer (prostate)	GAD: 20804486
Cancer (Renal cell)	GAD: 20572163
Cancer (Squamous cell)	GAD: 20086182
Cancer (bladder)	GAD: 19692168
Cancer (brain)	GAD: 17684142
Cancer (colorectal)	GAD: 18362937
Cancer (endometrial)	GAD: 19531679
Cancer (esophageal)	GAD: 20453000
Cancer (gastric)	GAD: 19269008
Cancer (breast)	GAD: 15601643
Clubfoot	GAD: 17534194
Hodgkin disease	GAD: 19573080
Multiple sclerosis	GAD: 20363033
Asthma	GAD: 18823309
Autoimmune diseases	KEGG: H00108
Diabetes	GAD: 18483392
Bone diseases	GAD: 19453261
Poor semen quality	MIK: 19542541
Altered sperm apoptosis	MIK: 19542541
Sperm motility	MIK: 26064412
Male factor infertility	MIK: 19542541
Male factor infertility	MIK: 26064412
Diminished ovarian reserve (DOR)	INFBASE: 16730720
Female infertility	INFBASE: 22999554
Chronic endometritis	INFBASE: 23351011
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Altered sperm apoptosis, poor semen quality	MIK: 19542541
Male infertility	MIK: 19542541
Sperm motility, Male infertility	MIK: 26064412
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19542541	Male infertility	FAS-670A/G (rs1800682: A>G), CASP8-652 6N ins/del (rs3834129: -/CTTACT)		620 infertile men	Male infertility	FAS FASLG and CASP8
19542541	Altered sperm apoptosis, poor semen quality	FAS-670A/G (rs1800682: A>G) and CASP8-652 6N ins/del (rs3834129: -/CTTACT)		620 infertile men	Male infertility	FAS FASLG and CASP8
26064412	Sperm motility, Male infertility		China	76 (19 asthenospermia, 20 oligoasthenoteratozoospermia, 17 azoospermia, 20 controls)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881