• Gene id: 84083

Gene Summary

• Gene Symbol: ZRANB3   Gene   UCSC   Ensembl
• Aliases: 4933425L19Rik, AH2
• Gene name: zinc finger RANBP2-type containing 3
• Alternate names: DNA annealing helicase and endonuclease ZRANB3, annealing helicase 2, zinc finger Ran-binding domain-containing protein 3, zinc finger, RAN-binding domain containing 3,
• Gene location: 2q21.3 (135531217: 135164217)     Exons: 25     NC_000002.12
• OMIM: 615655

Protein Summary

• Protein general information: Q5FWF4  
  • Name: DNA annealing helicase and endonuclease ZRANB3 (Annealing helicase 2) (AH2) (Zinc finger Ran binding domain containing protein 3) [Includes: DNA annealing helicase ZRANB3 (EC 3.6.4. ); Endonuclease ZRANB3 (EC 3.1. . )]
  • Length: 1079  
  • Mass: 123248
• Sequence:

  MPRVHNIKKSLTPHISCVTNESDNLLDFLPDRLRAKLLPFQKDGIIFALKRNGRCMVADEMGLGKTIQAIGITYF
  YKEEWPLLIVVPSSLRYPWTEEIEKWIPELSPEEINVIQNKTDVRRMSTSKVTVLGYGLLTADAKTLIDALNNQN
  FKVVIVDESHYMKSRNATRSRILLPIVQKARRAILLTGTPALGRPEELFMQIEALFPQKFGRWTDYAKRYCNAHI
  RYFGKRPQWDCRGASNLNELHQLLSDIMIRRLKTEVLTQLPPKVRQRIPFDLPSAAAKELNTSFEEWEKIMRTPN
  SGAMETVMGLITRMFKQTAIAKAGAVKDYIKMMLQNDSLKFLVFAHHLSMLQACTEAVIENKTRYIRIDGSVSSS
  ERIHLVNQFQKDPDTRVAILSIQAAGQGLTFTAASHVVFAELYWDPGHIKQAEDRAHRIGQCSSVNIHYLIANGT
  LDTLMWGMLNRKAQVTGSTLNGRKEKIQAEEGDKEKWDFLQFAEAWTPNDSSEELRKEALFTHFEKEKQHDIRSF
  FVPQPKKRQLMTSCDESKRFREENTVVSSDPTKTAARDIIDYESDVEPETKRLKLAASEDHCSPSEETPSQSKQI
  RTPLVESVQEAKAQLTTPAFPVEGWQCSLCTYINNSELPYCEMCETPQGSAVMQIDSLNHIQDKNEKDDSQKDTS
  KKVQTISDCEKQALAQSEPGQLADSKEETPKIEKEDGLTSQPGNEQWKSSDTLPVYDTLMFCASRNTDRIHIYTK
  DGKQMSCNFIPLDIKLDLWEDLPASFQLKQYRSLILRFVREWSSLTAMKQRIIRKSGQLFCSPILALEEITKQQT
  KQNCTKRYITKEDVAVASMDKVKNVGGHVRLITKESRPRDPFTKKLLEDGACVPFLNPYTVQADLTVKPSTSKGY
  LQAVDNEGNPLCLRCQQPTCQTKQACKANSWDSRFCSLKCQEEFWIRSNNSYLRAKVFETEHGVCQLCNVNAQEL
  FLRLRDAPKSQRKNLLYATWTSKLPLEQLNEMIRNPGEGHFWQVDHIKPVYGGGGQCSLDNLQTLCTVCHKERTA
  RQAKERSQVRRQSLASKHGSDITRFLVKK

• Structural information:
  • Protein Domains: (46..20-)
    (/note="Helicase-ATP-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00541-)
    (325..48-)
    (/note="Helicase-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00542-)
    (1011..105-)
    (/note="HNH"-)
  • Interpro: IPR014001  IPR001650  IPR002711  IPR003615  IPR027417   IPR038718  IPR000330  IPR001876  IPR036443  
  • Prosite: PS51192 PS51194 PS01358 PS50199
  • CDD: cd00085
  • PDB: 5MKW 5MLO 5MLW 5YD8
  • PDBsum: 5MKW 5MLO 5MLW 5YD8
  • STRING: ENSP00000264159
• Other Databases: GeneCards:  ZRANB3  Malacards:  ZRANB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048478	replication fork protection	IBA	biological process
GO:0043596	nuclear replication fork	IBA	cellular component
GO:0036292	DNA rewinding	IBA	biological process
GO:0031297	replication fork processing	IBA	biological process
GO:0008094	DNA-dependent ATPase activity	IBA	molecular function
GO:0006281	DNA repair	IBA	biological process
GO:0004520	endodeoxyribonuclease activity	IBA	molecular function
GO:0036310	annealing helicase activity	IBA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0048478	replication fork protection	IDA	biological process
GO:0048478	replication fork protection	IDA	biological process
GO:0045910	negative regulation of DNA recombination	IDA	biological process
GO:0043596	nuclear replication fork	IDA	cellular component
GO:0043596	nuclear replication fork	IDA	cellular component
GO:0043596	nuclear replication fork	IDA	cellular component
GO:0036292	DNA rewinding	IDA	biological process
GO:0036292	DNA rewinding	IDA	biological process
GO:0031297	replication fork processing	IDA	biological process
GO:0031297	replication fork processing	IDA	biological process
GO:0006281	DNA repair	IDA	biological process
GO:0004520	endodeoxyribonuclease activity	IDA	molecular function
GO:0003678	DNA helicase activity	IDA	NOT|molecular function
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0036310	annealing helicase activity	IDA	molecular function
GO:0036310	annealing helicase activity	IDA	molecular function
GO:0036310	annealing helicase activity	IDA	molecular function
GO:0009411	response to UV	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0008152	metabolic process	IEA	biological process
GO:0004518	nuclease activity	IEA	molecular function
GO:0004386	helicase activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0000733	DNA strand renaturation	IEA	biological process
GO:0000733	DNA strand renaturation	IEA	biological process
GO:0000733	DNA strand renaturation	IEA	biological process
GO:0000733	DNA strand renaturation	IEA	biological process
GO:0032508	DNA duplex unwinding	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray